(data stored in SCRATCH zone)

EMBL: CP000423.PE351

CP000423.PE351       Location/Qualifiers
FT   CDS_pept        complement(360363..360557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69217"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C55"
FT                   /protein_id="ABJ69217.1"
FT                   /translation="MDEKKVLKTIDEMLADPWQVDIQELFEASFNEPDEIKKNLYDSLY
FT                   TYVLQKRQEDIINRPGFVI"
     atggacgaaa agaaagtatt aaaaaccatt gatgaaatgc ttgctgatcc ttggcaagtt        60
     gatattcaag aattgtttga agcttctttc aatgaacctg acgagatcaa aaagaatttg       120
     tatgattccc tgtatactta tgttttgcaa aaaagacaag aagatattat taatcgtcct       180
     ggcttcgtta tttag                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page