(data stored in SCRATCH zone)

EMBL: CP000423.PE371

CP000423.PE371       Location/Qualifiers
FT   CDS_pept        378311..379606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0379"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69237"
FT                   /db_xref="GOA:Q03C35"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C35"
FT                   /protein_id="ABJ69237.1"
FT                   /translation="MNISVLVDYVLIALVGGVGSILANRGIAVFNDGLRPIMPEYLEGK
FT                   IDRKELAATSFAVSFGLIIGFGIPVSIGSTILVAHSILLAADIIGTWTPANKWGTALAG
FT                   VVGAVYGVGLLFGLSFIVSAFKMLPVNFLGALSLLGGPILLAFCAFPALAVASQHGAKK
FT                   GMITFGATFVAYLLATKFGVFSVGNGIKITLNPIGMSLLVAMLFMLYFAAQIKGEGTSN
FT                   ASLVNVFSARVSRIKKNWIWLSIMGGLITAASSVLIIAVDVLPQQLLVKGQVMEAAIAT
FT                   LARAIGFIPLVFSTAIVTGVYGMAGTTIIFAIGLLLKGNPIVAFIAGFVWMWIEVQALA
FT                   GTAKGLDKFPGLRDMGEHIRTSLTDTIAIALLIGAALACNKMAPNLGYFWVIGVWLLNK
FT                   KLKKPLVDMAVGPIAAIALGILLNLLRIVHLF"
     atgaatattt cggtcttagt agactacgtg ttaatcgcgt tagtcggagg cgtgggttcg        60
     attttagcca atcgcggcat tgcggtcttt aatgatggct tgcgaccaat tatgccagag       120
     tatctggaag gcaagattga tcgcaaagaa ttggctgcta ccagctttgc cgttagtttt       180
     ggcttaatta tcggctttgg gattccggta tctatcggct caacaatctt ggtagcgcat       240
     agtattctgc ttgctgctga tattatcggc acatggaccc cagccaacaa atggggcact       300
     gcactggctg gtgttgttgg tgccgtgtat ggtgttggtc ttctgttcgg cctttcattt       360
     attgtttcag cgttcaaaat gcttcccgtt aacttcctag gggctttgtc actgctaggc       420
     gggccgattt tgttagcttt ctgtgcattc ccagccctgg cagttgccag tcaacatggg       480
     gcaaagaaag gcatgatcac ttttggggcg acattcgttg cttaccttct tgccacaaaa       540
     ttcggggttt tctcagttgg caatgggata aaaatcacgt taaacccaat tggaatgtca       600
     ctcttagtcg caatgttatt catgctttac tttgccgctc aaattaaagg cgaaggcaca       660
     tcaaatgcaa gtctggtaaa cgtcttttcg gcccgagttt ctcggattaa aaagaattgg       720
     atttggttgt ccatcatggg cggcttaatt actgctgcat caagtgtctt gattattgca       780
     gttgacgttc taccacaaca attactggtt aaaggccaag tcatggaagc cgccattgca       840
     acattggccc gtgcgattgg atttattccg ctagtcttct ctactgccat tgtaactggt       900
     gtctatggca tggccggcac cacgatcatc tttgcaattg gccttttatt gaaaggcaat       960
     ccgattgttg cgtttattgc cggatttgtt tggatgtgga ttgaagtcca agcacttgct      1020
     ggtactgcta aaggtttgga taaattccct gggttgcgtg atatgggtga acatattcga      1080
     acttctctaa ctgatacgat tgcgatcgcc ttgctgattg gtgctgcgtt ggcctgcaat      1140
     aagatggcgc ctaaccttgg ttacttctgg gtgatcggag tctggctgct gaacaagaag      1200
     ctgaaaaagc cccttgttga tatggcagtg ggaccaattg ctgctatcgc gcttggaatt      1260
     ttgctgaatc tgttacgaat cgtacatctg ttttag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page