(data stored in SCRATCH zone)

EMBL: CP000423.PE425

CP000423.PE425       Location/Qualifiers
FT   CDS_pept        complement(439940..441007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0436"
FT                   /product="L-alanine-DL-glutamate epimerase related enzyme
FT                   of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69291"
FT                   /db_xref="GOA:Q03BY1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BY1"
FT                   /protein_id="ABJ69291.1"
FT                   /translation="MEITAITAFPRQVKLKTPFKLALGELRDITTLIIKIETDDGVTGY
FT                   GEASPYAPVNGETNETEQAALPVFVNALTGCDPRNLEQVHARMDVVMAGHTALKCGIDT
FT                   ACSDILGKAASLPLWQLLGGHSHIVTTDITIPIGTPTQMVASARTYVAAGFTALKLKAG
FT                   DNEAADIAAINAVCAAVGPTISVKVDANQAWTVSQTLRIAAQLRAPNLIAIEQPVPDWQ
FT                   LLSLPLLRAQSHVALMLDESIHNAHDAADAIRLNAADLINIKLAKSGGLFGAAAIDATA
FT                   AAAGVPCMVGCNAETRLGTAASAHFIAAHENVHYGDIDSFMLLAETDWLSGGFTSDGPT
FT                   LTLSDRPGLGVDVRL"
     atggaaatca cagcaatcac ggcgttccct cggcaggtaa aacttaaaac gccttttaag        60
     ttagccttgg gcgagttgcg ggacatcacc acactgatca tcaaaatcga gactgatgat       120
     ggcgtcaccg gctatggtga agcctcgcct tacgcaccgg taaatggcga aaccaatgaa       180
     accgaacaag ctgctctgcc agttttcgtc aatgctttaa ctggctgcga tccgcgcaat       240
     cttgaacagg tgcatgcacg catggatgtc gtgatggctg gtcatacagc attaaaatgt       300
     gggattgaca ccgcctgtag cgacatttta ggtaaagcag ccagcttgcc gctatggcaa       360
     ctgcttggtg gtcatagcca tatcgtcacc acggatatca cgattccgat tggcactccg       420
     actcaaatgg tggcttcagc gcggacatat gtggccgctg gtttcacggc attaaagtta       480
     aaagctgggg acaacgaagc cgccgatatc gccgccatta acgcggtgtg tgctgcagtc       540
     ggccccacca tctcggtaaa agtggatgct aatcaagctt ggactgtatc gcaaacgtta       600
     agaattgcag cccaactcag agcccccaat ttaattgcca tagaacagcc ggtgcctgat       660
     tggcagttgc tgtctctacc tttgttacgc gcacagtcac acgttgcctt gatgcttgat       720
     gaaagtatcc acaacgccca tgatgctgcc gatgctattc gcctgaacgc cgccgatttg       780
     atcaacatca agctggctaa atcgggcggg ctgttcggcg ccgcggcgat tgacgcgact       840
     gccgcagctg ccggcgtacc ttgcatggtc ggttgcaatg ccgaaactcg cctaggaaca       900
     gccgcatccg ctcacttcat cgccgcacac gagaatgtgc actacggcga tatcgacagt       960
     ttcatgttgc tggcagaaac tgactggctt agcggcggct tcacctcaga cggtccgacc      1020
     ttaaccttat cagatcgacc aggcctcggc gttgacgtcc gactttaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page