(data stored in SCRATCH zone)

EMBL: CP000423.PE45

CP000423.PE45        Location/Qualifiers
FT   CDS_pept        43819..44091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0046"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68911"
FT                   /db_xref="GOA:Q03D11"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D11"
FT                   /protein_id="ABJ68911.1"
FT                   /translation="MRVVPIVLVKRMTIPKWLLHFLSFVPVAILSAIFVESLLVIHPGQ
FT                   WPGVNWSNLLASLPAIAVAIITKSLFAVVVAGVASMAILRLLGWA"
     ttgcgggtcg tgccgattgt cttggtcaaa cggatgacga tccccaaatg gctgctccat        60
     tttctcagtt ttgtgccggt ggcgattctt tcggccatct ttgttgaaag cctgctggtg       120
     attcatcctg gtcagtggcc aggcgtcaac tggtcgaacc tattggcatc acttccggcc       180
     attgcggttg ccattatcac gaagagcctc ttcgccgttg tggtcgcagg cgttgcttcg       240
     atggcaattt tgcggctgct gggctgggcg tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page