(data stored in SCRATCH zone)

EMBL: CP000423.PE454

CP000423.PE454       Location/Qualifiers
FT   CDS_pept        complement(484252..484815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69320"
FT                   /db_xref="InterPro:IPR022263"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BV2"
FT                   /protein_id="ABJ69320.1"
FT                   /translation="MYKLNPFSQEKRRYKMYKAGRHWIYSAIAVLGGAGILMFQPTQTV
FT                   FADEASPTASATTLAKSHTELKDKQPVTASPTPTDNPQPSVDKPAAPAIETQPTSAANQ
FT                   VEAPSTKPADHSKAASDSHAASIVSATPTATPKTAPVATDKVKVTVPVETQRHQSWRQP
FT                   LLRDLRSKQSQHLRQPNHRLIRPF"
     gtgtacaaac tgaatccctt ttcacaggaa aaacgccgct ataagatgta taaggccgga        60
     cggcattgga tttatagtgc cattgctgtt ttaggcggag ctggcattct gatgtttcag       120
     ccaacgcaaa ccgtttttgc tgatgaagca tcaccgactg ccagcgcgac gacacttgcc       180
     aaatcgcata ccgaactcaa agacaaacag cccgttaccg catcaccgac tcccactgat       240
     aacccccagc ccagcgttga caaaccagcg gcccccgcaa ttgaaactca gccaacatca       300
     gcggccaatc aagtcgaagc gccttcaaca aaaccggctg accattcgaa ggcagcgtct       360
     gacagccatg ccgcatcgat cgtatcagca acaccaaccg ctacgccaaa aactgcacct       420
     gttgcaaccg ataaagttaa agtcactgtg cctgttgaaa cacagcgtca ccagtcatgg       480
     cgccaaccgc ttctccgcga tctgcggtcc aaacaaagcc aacacctgcg ccagccaaac       540
     caccgattaa tcaggccgtt ttaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page