(data stored in SCRATCH zone)

EMBL: CP000423.PE471

CP000423.PE471       Location/Qualifiers
FT   CDS_pept        complement(502541..502801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69337"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BT5"
FT                   /protein_id="ABJ69337.1"
FT                   /translation="MKPITVISYKFGEKTWKNFEGEPIKKYEHSVLLDISDTEVFTDKE
FT                   KTELNDKIVVPFSRIREKRFIKDIPLSNVNEALNKKKAGRK"
     atgaaaccaa ttacagtaat ctcttataag tttggcgaaa aaacttggaa aaattttgaa        60
     ggagaaccga tcaaaaaata tgagcactca gttctcctag acatttcaga caccgaagtc       120
     ttcactgata aagaaaaaac agaactaaac gacaagatcg ttgtcccctt ttctagaatt       180
     agagaaaaac gattcatcaa agatattccg ctcagtaacg taaacgaggc acttaacaag       240
     aaaaaagcag gcaggaaata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page