(data stored in SCRATCH zone)

EMBL: CP000423.PE490

CP000423.PE490       Location/Qualifiers
FT   CDS_pept        511011..511127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69356"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BR6"
FT                   /protein_id="ABJ69356.1"
FT                   /translation="MQSRGQTSLDMIKFEADLMDVRQNIADQCFHEGGVDHE"
     atgcaatcta ggggtcaaac atcactcgat atgatcaaat tcgaagcaga cttaatggat        60
     gttcgccaaa acattgccga tcaatgcttt catgaaggcg gtgtcgatca tgaatga          117
//

If you have problems or comments...

PBIL Back to PBIL home page