(data stored in SCRATCH zone)

EMBL: CP000423.PE492

CP000423.PE492       Location/Qualifiers
FT   CDS_pept        511881..512705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0508"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69358"
FT                   /db_xref="GOA:Q03BR4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BR4"
FT                   /protein_id="ABJ69358.1"
FT                   /translation="MSNLETNQGRLAAIETFAERCPDCGSLLYRPKGLSKVTGKKMAGV
FT                   CMNCGYKQPPTEPKNVTPDMEKEARKNRTVGYYLAYSVFSTDAIIAKDFNNFHTDGSLG
FT                   QQQLKLFAVGLSNKICRNEVVHALIIGDTGVGKSHIANGILIDTQAKTGYRKTCLFIDW
FT                   NALMQRLKSGMSANAQDVRMKNEKIMHEIGKADVVVIDDLGSERGSDFDRQTADDVFRM
FT                   REDKATIVTTNLHGQDLNKRYGERTMSRMAKHGQGNSFGVKGILDQRKEALP"
     atgagcaatc ttgaaactaa tcaaggacgc ttagcagcga tcgaaacatt tgctgaacgt        60
     tgtcccgatt gtggcagcct cttgtatcgc ccgaagggat tgagcaaagt aaccggtaaa       120
     aaaatggccg gagtgtgcat gaattgtggc tataaacagc cacccacgga gcctaaaaac       180
     gtcacgccag atatggaaaa agaggcccgc aagaaccgca ccgttggata ctacctagct       240
     tattcggtat ttagtacaga cgcgattatt gcaaaggatt tcaacaactt ccatacagat       300
     ggcagccttg gacagcagca gttgaaactc ttcgctgtcg gtttgtctaa caaaatatgc       360
     cgtaacgagg ttgtacacgc attgattatc ggtgacacag gagttggcaa gtcacatatt       420
     gctaacggca tattaattga tactcaggcc aagaccggtt atcgcaaaac atgccttttt       480
     attgactgga acgctttaat gcagagactc aagtctggca tgagtgctaa tgcacaagat       540
     gtgcgaatga agaacgagaa aattatgcat gagattggca aggctgatgt ggttgtgatc       600
     gatgatctag gctccgagcg tggtagtgat tttgaccgcc agacggctga tgatgttttc       660
     agaatgcggg aagacaaagc aactatcgtg acaaccaatt tgcacggaca agatctgaat       720
     aagaggtacg gcgagcgaac tatgtcccgt atggccaagc acggccaagg aaatagcttt       780
     ggcgttaaag gaatcctaga tcagcgaaaa gaggcgttgc cttga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page