(data stored in SCRATCH zone)

EMBL: CP000423.PE495

CP000423.PE495       Location/Qualifiers
FT   CDS_pept        513694..514431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69361"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BR1"
FT                   /protein_id="ABJ69361.1"
FT                   /translation="MTTEADALKFTAEQAVTANGKRIIETKNRQFLINGNGDIREFRPN
FT                   DGANEALQVHTLTAVVDYIGKVSERSASPLIVQVVDENSVFVLGELDDFGNREVLIKAK
FT                   AMHPCYPYGQWLDSESFIIALQAQFMTTEDGKVLLKFVGNLKDESAQTMVDDGVSQVAT
FT                   ARSGVASVGKVVVPNPISLRPYRTFLEVEQQESDFVFRMHEGPKLALFSADGDAWRNTA
FT                   IDLVAEYLSEKLVKFSKHVTVLA"
     atgacaacag aagcagatgc acttaaattc acagcagaac aggcagttac tgcaaatggt        60
     aaacgaatta tcgaaacaaa aaatcgtcaa tttttgatta atggtaacgg tgatataagg       120
     gaatttagac caaatgatgg agcaaacgaa gcgttacaag ttcacacatt gactgcagtt       180
     gtcgattata tcgggaaggt cagcgaacgt tctgccagtc ccttaattgt gcaagtagtc       240
     gatgagaaca gcgtattcgt attaggagag ctcgatgatt ttggcaaccg ggaagtcttg       300
     atcaaggcca aggcaatgca tccctgctac ccatacggtc aatggctgga ttcggaatca       360
     ttcatcatcg cattgcaggc acaattcatg accactgagg atggcaaagt gttgcttaaa       420
     tttgttggta atcttaaaga cgaatctgca cagacgatgg ttgatgacgg tgtaagccaa       480
     gttgcaaccg cacgcagtgg tgtggcatcc gttggcaagg tagttgtccc gaatccaatc       540
     tcactacggc catatcgtac atttctggaa gttgagcaac aggaaagtga ttttgtcttt       600
     cggatgcatg aaggtccaaa attggcgctc tttagtgctg acggtgatgc gtggcggaac       660
     acagcaattg atcttgttgc cgaatacctt agtgagaagc ttgtaaaatt tagcaagcac       720
     gtgacagtac ttgcgtaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page