(data stored in SCRATCH zone)

EMBL: CP000423.PE504

CP000423.PE504       Location/Qualifiers
FT   CDS_pept        520453..520788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69370"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BQ2"
FT                   /protein_id="ABJ69370.1"
FT                   /translation="MNSTNAMKRVGYGYVSHTEQAIIEKLSREEKHMQAIIYTKPHCQK
FT                   CRRTVFKLSRVMPVQTITADADDYERFRKLGYRSMPVVTIYEADGTHDEWCDLRVDKIK
FT                   QYTEGNI"
     atgaactcaa ctaatgcgat gaagcgagtc gggtacggat atgtaagcca cacagagcaa        60
     gcaatcattg agaaactatc gagagaagag aaacacatgc aagcaatcat ctacacaaag       120
     ccacactgcc aaaagtgtcg gcgaacagta ttcaagctgt cacgagtcat gccagtgcaa       180
     accatcacag cagacgcgga cgactacgag cggttccgca agctaggcta tcgttcaatg       240
     ccagtcgtaa caatctacga agcagacggc acacacgatg aatggtgcga tttaagggtt       300
     gataagatca agcagtacac ggagggaaac atatga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page