(data stored in SCRATCH zone)

EMBL: CP000423.PE515

CP000423.PE515       Location/Qualifiers
FT   CDS_pept        527768..528187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0532"
FT                   /product="Single-strand binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69381"
FT                   /db_xref="GOA:Q03BP1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BP1"
FT                   /protein_id="ABJ69381.1"
FT                   /translation="MEDINSVQLSGTVITDVKHRQNQDFLTASTYLECIRDHQDRTKKV
FT                   NVPVKLYNETAADFVKNVKLGDRVLITGRFDASVFSEAPGQSTTRYFIMAASFVKIVKE
FT                   AVPAVDDKLNNPPKATHDTPTESSNYSNVLPGGFN"
     atggaagaca tcaatagtgt tcaattatca ggaaccgtca taaccgatgt gaaacaccgc        60
     caaaatcagg attttctaac cgcttctacc tatttggaat gtattcgaga tcatcaagat       120
     cgtactaaga aggtcaatgt tcccgttaaa ctttataacg aaactgccgc agatttcgtt       180
     aagaacgtta agctgggtga tcgtgttttg atcactggtc gctttgacgc cagtgtgttc       240
     agtgaggcac cagggcaatc aacgaccaga tacttcatta tggccgccag tttcgtcaaa       300
     atcgttaaag aagccgtacc ggcagttgat gataagctga acaatccacc taaagcgaca       360
     cacgacacac ccacagagtc atcgaactac agcaatgtat taccgggagg cttcaactag       420
//

If you have problems or comments...

PBIL Back to PBIL home page