(data stored in SCRATCH zone)

EMBL: CP000423.PE518

CP000423.PE518       Location/Qualifiers
FT   CDS_pept        531257..533314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69384"
FT                   /db_xref="GOA:Q03BN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BN8"
FT                   /protein_id="ABJ69384.1"
FT                   /translation="MSTIEYLEKFQPVLHKATWINDGLRWIGWQIIRMLANLADGLTSM
FT                   YSQAFKLIDFWNSKDVSGFVAAYQPIFWVLCTLGIAWVGFMMIHRTKTDFHQKINNLMV
FT                   ALFIFIGLGTLTSTLSGLVVAGVGTSLQKARPAVSIVSNNMTDLMRVNNDGWKSLSPNP
FT                   STSIKTIDDVNNLDINETLDTGNTLLNHAGSKLNATGNEIMSHQLTMGGDGKYQLRDMK
FT                   AFFHDIAYYRYSFHPYLTFFELFAFTIAIILVIIKVFVSIMEIGFITMLAQGMALSDID
FT                   SGKRNLALIQKLRDTFIVLFLTSVMLQLFTFWTSALANPANQQSPVAQCFGIIAGAMFL
FT                   INGPNIVTSLFGMDGGARGIGATLVGGAMGLRAAGGIGRGMARGVSNAAHATVHGAARA
FT                   AGYGAGFANAFRSNKSNRSSGSKPSIDGIGAEAAKQDAATPDLETPATTDPALGKQSGT
FT                   DANPTSSSIAGPDMASLSGTEAASEAPATTGPDMASLSGTEPASEMPAASGPDMASLSG
FT                   TEPASEAPAAAGPDMASLSGSEPMQGDQGELSRPKTAQRTMGQPAPKGSNFATGTNTRG
FT                   QSATSNVGSQAGNRSSIGNTSPDSGTQVESETQAVDTGSTPQQIPAETRTLGQMWGGRV
FT                   VPGLAKHSQTVRLAQRSYNRGAAIPSNTRQVIQSAKNSYQNHNEQPTFRR"
     ttgagtacca ttgaatattt ggaaaagttt cagccagtgt tgcacaaagc aacatggatc        60
     aacgatggcc tacggtggat tggctggcaa atcattcgta tgttagcgaa tttggctgat       120
     ggcttgacca gtatgtacag tcaagcgttt aaactcatcg acttttggaa ctcaaaagat       180
     gtcagtggct ttgtcgccgc gtatcagccc atcttttggg ttctttgtac gttgggtatt       240
     gcctgggtcg gtttcatgat gattcatcgt accaagactg actttcacca gaagatcaat       300
     aatctcatgg tggcgttgtt tatcttcatt ggccttggta ccttgacgtc aaccctgtct       360
     ggattggtcg ttgctggcgt cggaacatca ctacaaaaag ctcgtccggc ggtctcaatc       420
     gtctccaaca atatgactga tttaatgcgg gtcaacaatg atggttggaa atccctatca       480
     cccaatccaa gcacgagcat taaaacgatt gacgacgtca ataacctaga tattaatgaa       540
     acactggata ctgggaatac gctattgaat catgctggtt ccaaactaaa tgcgactggg       600
     aatgaaatca tgtcgcatca gctgacaatg ggcggtgacg gtaagtatca attacgcgat       660
     atgaaggcat tcttccacga tattgcttac taccgttact cttttcatcc gtatctgacg       720
     tttttcgagt tatttgcgtt taccattgcg atcatcttgg tcattatcaa ggttttcgta       780
     tccattatgg aaatcggttt tattaccatg ctggcgcaag gaatggcatt gtctgatatt       840
     gattcaggca aacgtaattt agccttgata caaaagctgc gcgatacctt cattgtgttg       900
     tttttaacct cggtaatgtt acaactattc accttctgga caagtgccct tgcgaatcca       960
     gcaaatcaac aaagcccagt agcacagtgt ttcggaatta ttgctggagc catgtttttg      1020
     attaatggtc caaacattgt gacaagcctg tttggcatgg atggaggagc acgcggtatt      1080
     ggggcaaccc ttgttggtgg tgcgatgggt cttcgtgccg ctggtggcat aggtcgtggt      1140
     atggcacggg gtgtcagcaa tgcggcacac gcaacggtgc atggcgctgc tcgtgcggcg      1200
     ggatatggtg ctggttttgc aaatgcgttt aggagcaata agagtaatcg ttctagcggt      1260
     agtaaaccat ccattgatgg aattggcgca gaagccgcaa aacaagacgc agcgacacct      1320
     gatctggaaa caccagcgac aacagatcca gcgcttggca aacaaagtgg cacagacgct      1380
     aatccaacct catcgagcat tgccggtcca gatatggctt cgttgagcgg tacagaggca      1440
     gccagtgagg caccagcaac cacggggcca gatatggctt cactgagtgg cactgaaccg      1500
     gcaagcgaga tgccggcagc ttctgggcca gatatggctt cgttgagtgg cacagaacca      1560
     gccagtgagg cgccagcagc cgctgggccg gacatggcct cacttagtgg gagtgaacca      1620
     atgcaaggag atcaaggcga gctttcaaga cctaaaacag cacaacgtac gatggggcaa      1680
     ccggctccaa aaggatcaaa ctttgcgact gggactaaca cccggggcca atcagcgacc      1740
     agcaacgttg gtagtcaggc gggaaaccga tcatcaatcg ggaatactag tccagatagt      1800
     ggtacgcaag tagaatctga aacgcaagcc gttgatactg gctcaacgcc acagcagatt      1860
     ccggctgaga cacgaacgct tggccaaatg tggggtggca gagtcgtccc gggacttgcc      1920
     aagcattcgc aaaccgttcg gctggcacag cgttcctaca atcgcggtgc tgccattcca      1980
     agcaatacac gccaagtaat ccaaagtgca aagaactcat atcaaaatca taatgaacag      2040
     ccaaccttta ggaggtga                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page