(data stored in SCRATCH zone)

EMBL: CP000423.PE523

CP000423.PE523       Location/Qualifiers
FT   CDS_pept        537172..537816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69389"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BN3"
FT                   /protein_id="ABJ69389.1"
FT                   /translation="MNRKTMLVSVMMILALGAGAYGWASANTANKNISQQKQELRIMAS
FT                   KNESLETQLEALKISNQVNHASSNSDSASKKANTTSSQSDNLTDTTQKISAMMNGLLQG
FT                   MYSPKKATTMGQYEAMKPYLTGEAIQTFMPDRDTPISANGFQESTINDLRVFVTPQGDD
FT                   YLLMARYELGNNKTNTNKKTTMVFQGTVRKVSNDYKLAAFDSNRALSGVTP"
     atgaatcgta aaacaatgct ggtcagtgtc atgatgatcc tcgcacttgg tgccggtgcc        60
     tatggctggg cgtcagccaa tacagccaac aaaaacatca gtcagcagaa acaagaactc       120
     cgtatcatgg cgtctaaaaa tgaatcatta gagacgcaat tagaggcgct taaaatttct       180
     aatcaagtca atcatgcgtc aagcaactct gacagcgcga gtaaaaaagc aaacacgaca       240
     tcatctcaat cagacaatct aacagacaca acacagaaga tctcagcaat gatgaatggt       300
     ctgttgcaag gcatgtactc gcctaaaaag gccaccacaa tgggtcagta tgaagccatg       360
     aaaccttacc taacgggtga ggcgatccag actttcatgc ctgatcgtga tacacccatt       420
     agtgcaaatg ggtttcaaga atcgaccatt aacgacttgc gcgtttttgt cacgccacag       480
     ggtgatgact acttgttaat ggcacgttac gaacttggta acaacaagac caacacaaat       540
     aagaaaacca cgatggtttt tcaaggcacg gtcaggaagg ttagcaatga ctacaaatta       600
     gctgcctttg attctaaccg cgcactatcg ggggtgacac cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page