(data stored in SCRATCH zone)

EMBL: CP000423.PE529

CP000423.PE529       Location/Qualifiers
FT   CDS_pept        540528..541772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69395"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BM7"
FT                   /protein_id="ABJ69395.1"
FT                   /translation="MPSRVSPGIVNVTDFVAAHAKKFGSYINYIDRDEAIRIDHFDQQN
FT                   ILSVDGYNHYMENPKKSSGIFTDQYDHLTPTQRVQLKKQFTVAQKHQSVMWQSVFSFRN
FT                   DFLAENNVYNPKTKQLDEAKLRDATRVAMNDFTGKMGMTHSAIWSAAIHRNTDNIHIHV
FT                   AIVEPQPTREWKRVTVEGKHGETYQEWQRKGYVPKKILNHFKAAFANEMVDRDRSLARI
FT                   SDLIRQRLQPDQRSVWRHQSSLDFAVRYQELVKSLPRDRRLWKYNNNAMKPYRDQLDAM
FT                   SRNYLMRCKPEELGEFKQLLAQETRFREALYGSGTKEANRAQDYTDNKLHELYARMGNS
FT                   ILKDISAYRTEQEAVSQTHHQPSVANHLNGLQKIFNADIKAQRLAEREYQRRQADQDRE
FT                   REQDKKKQEQQTRFY"
     atgcctagtc gagtatcacc tggcattgtc aatgtgaccg attttgtcgc agcccatgcc        60
     aaaaagtttg gcagctacat caattacatt gatcgagacg aggcaattcg gattgatcac       120
     tttgaccaac aaaacattct gtcagttgac ggctacaacc actacatgga gaatccgaaa       180
     aagtcttccg gtatcttcac tgatcaatac gatcatctaa caccaacaca acgcgttcag       240
     ttaaagaaac aattcaccgt tgcacaaaag catcagtcag tcatgtggca gtccgtattc       300
     agtttccgaa atgacttcct agctgaaaac aatgtctaca atccgaagac caaacagtta       360
     gatgaagcca agttgcggga cgctacccgg gtcgccatga acgacttcac cggtaaaatg       420
     ggtatgacac attccgctat ttggtctgct gcgattcacc gcaacacgga caacattcat       480
     atccacgttg ctattgtgga gccacaacct acccgtgaat ggaaacgagt tacggtcgaa       540
     ggtaagcacg gtgagaccta tcaagaatgg cagcgcaaag gttatgtacc taagaagatc       600
     ttgaaccatt tcaaggcggc ctttgccaac gaaatggttg atcgcgatcg ctcacttgca       660
     cggatcagtg acctcattcg tcaacgacta caacccgatc agcgttctgt ttggcgtcat       720
     cagagcagcc tagactttgc cgttaggtat caagagcttg tcaaaagctt gccccgtgat       780
     cgccgtcttt ggaagtacaa caacaatgcc atgaagccct atcgcgatca gttagatgcc       840
     atgtcacgaa actatttgat gcgttgtaag cctgaggagt tgggtgaatt taaacaacta       900
     ctcgcacaag aaacacgttt tcgtgaagcc ttgtatggca gtggcacaaa agaagccaat       960
     cgtgcgcaag actacaccga taacaaatta catgaactgt atgcccggat gggtaacagt      1020
     attttaaaag atatatcagc ttaccgtacc gaacaagaag ctgtttctca aacacatcat      1080
     caaccatcag tagccaatca cttgaatggc ctacagaaga ttttcaacgc cgatatcaag      1140
     gcacagcggt tagccgaacg cgagtatcaa agacgccagg ctgatcagga tcgagaacgt      1200
     gaacaagaca agaagaaaca ggaacagcag acgcgctttt actag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page