(data stored in SCRATCH zone)

EMBL: CP000423.PE536

CP000423.PE536       Location/Qualifiers
FT   CDS_pept        545877..546758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69402"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BM0"
FT                   /protein_id="ABJ69402.1"
FT                   /translation="MKLTAKWLLALSTVLGISISGCSAVQGSNSGQSNTTKSAPSYAVS
FT                   TSTTEDAQANSELANLPFDLAKYPQNYTTVNQNVPIFENGFKQTVAAAQKAKTTRAQTY
FT                   FDSLDDLGRTQTVSAIITYGMMHSHASSVRKRPAFPKTTKVSGEYADGVYNKNLQQWFG
FT                   RSDNNRMVQLNGYRGYLYNKSHLLTWSLGGNMQTHNVILGTRAQNVGTNDQRNPGGMAY
FT                   TETLTRNYLSSHQDDAVAYQVIPVYVGQELVPRGTHVLVQSIDNPNKFHLNVWVFNTQA
FT                   GRTINYNNGSFQ"
     atgaaattaa cagcaaaatg gcttttagcc ctcagtacag tattaggaat tagtatcagt        60
     ggttgttcag cagttcaggg ttcgaattca ggtcagtcaa atacaaccaa atctgcacca       120
     tcctacgctg tatcaacgag taccactgag gacgcgcagg caaacagtga gcttgccaac       180
     ttgccatttg atttggcaaa gtatccgcaa aactacacaa cggttaatca gaatgtccca       240
     atttttgaaa atggttttaa gcaaacggta gctgccgcgc aaaaagcaaa aacaacacgc       300
     gctcaaactt actttgacag cttagatgac ttgggtagaa cacaaacggt ctctgccatt       360
     attacttacg gtatgatgca cagtcacgca agctctgtgc gcaagcgacc agcctttcct       420
     aaaaccacga aggtctccgg tgagtacgct gatggcgtgt ataacaagaa cctacaacaa       480
     tggtttggcc gcagcgacaa taaccgaatg gtccaactta acggttatcg aggttatctg       540
     tataataaaa gccacctgtt aacgtggtca ctaggtggca atatgcagac tcataatgtt       600
     attcttggca ctcgtgctca aaatgttggc actaatgacc aacggaatcc cggtggtatg       660
     gcttacacgg aaactctgac gcgcaattat cttagctcac accaagacga tgctgtcgct       720
     tatcaagtca ttccagtata tgttggtcaa gagcttgtgc cgcgtggtac acatgttctg       780
     gtgcagtcca ttgataaccc aaacaaattt cacttaaatg tctgggtctt taatacgcaa       840
     gcaggaagaa caattaacta caataatggt tcatttcaat ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page