(data stored in SCRATCH zone)

EMBL: CP000423.PE545

CP000423.PE545       Location/Qualifiers
FT   CDS_pept        554207..554539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0563"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69411"
FT                   /db_xref="GOA:Q03BL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BL1"
FT                   /protein_id="ABJ69411.1"
FT                   /translation="MTIDEMTKGYEKEVAYQKHMLKNLGYWFQLCTILSGVGIVLIYFF
FT                   HGKTLWLNIVGIVLIVLGALGMLMFGYSGWKGQQNVRAVVDDYDKKIKYFQKKVRQQTG
FT                   ITPKAK"
     atgacaattg acgaaatgac taagggatac gaaaaagaag ttgcttatca gaagcatatg        60
     ttgaaaaacc taggctactg gtttcaactt tgcaccattc tcagtggcgt tggcattgtt       120
     ctgatctact tcttccatgg caagaccttg tggttaaaca tcgttggcat tgtgctcata       180
     gtcctgggtg cactggggat gttgatgttc ggatattcag gttggaaagg gcagcagaat       240
     gttcgcgcgg ttgttgacga ctatgacaag aaaatcaaat attttcaaaa gaaggttcgt       300
     cagcagacgg gcattacgcc caaagccaaa tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page