(data stored in SCRATCH zone)

EMBL: CP000423.PE549

CP000423.PE549       Location/Qualifiers
FT   CDS_pept        complement(560544..560723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69415"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BK7"
FT                   /protein_id="ABJ69415.1"
FT                   /translation="MGTWNNLQEGFKVNERLPDTLVDVAVWHVFNRATQLYRQAPQIKK
FT                   PPCVTLAGYRTTSI"
     atgggaacat ggaataatct tcaggaaggt ttcaaagtca atgaacgtct tccagacact        60
     ctcgttgatg ttgctgtttg gcacgttttt aatcgcgcta ctcagctata tcgacaggca       120
     ccacaaataa aaaagccgcc ctgtgtaact ttggcaggtt acaggacgac tagtatctag       180
//

If you have problems or comments...

PBIL Back to PBIL home page