(data stored in SCRATCH zone)

EMBL: CP000423.PE559

CP000423.PE559       Location/Qualifiers
FT   CDS_pept        complement(568828..570231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69425"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q035J7"
FT                   /protein_id="ABJ69425.1"
FT                   /translation="MYASKVVQLSIEAFGEANGVKLSPDNRWVQAATLIPWPELEEAYK
FT                   TVFPSNKGRAGKPFRLLFGAHLIKTREGLSDRELVDAIRDVPAYQFFMGLPEYQPRRPF
FT                   VPSAMAHFRKRIAPIAELLENIIGDWTRKQLVGSVDDKVVILDATVTPVNIKYPQDYVL
FT                   LGQARRNTEAMVTDLAHKLEVPIPRTYRREAERNYVHFTKHPKRTRKATRGMVKSQLQY
FT                   LRRNLRYIHEFQDQGGQLTSKQTQRLEVIETLYEQQDYMYRNNTHSVERRIISLSQPFV
FT                   RPIKRGKAKPRNGTEFGPKVDVSIIDGVVGIERFSFDNFNENQDFEDALYHYHDVHGEF
FT                   PDMALVDKLYRTRENLRIAKNLGVKVCGPKLGRQPKYPDEASERKAKKEAREAENARGE
FT                   IERNFALMKLKHGLGLVRAKTVETITTTVFTAMITANIDAVLRLFSLPFVLYVRYEGQI
FT                   LKIEYNDSI"
     atgtatgcat ctaaggttgt tcagctatca attgaagcgt ttggtgaagc aaatggcgta        60
     aaacttagcc ctgataatcg ttgggttcaa gcagctacct tgattccgtg gcccgagctt       120
     gaagaagcct acaaaactgt ctttccttca aacaaaggcc gtgcaggcaa accatttcgc       180
     ttgttatttg gcgcgcatct aatcaaaact cgtgaaggtt tgtcagatcg agaattagtt       240
     gatgccattc gtgatgtacc agcgtaccaa ttcttcatgg gactacctga gtatcaacca       300
     cggcggccat ttgttccgtc cgcaatggct catttccgca agcgtattgc cccaatcgct       360
     gagcttctgg agaacatcat tggtgactgg acaagaaagc aactagttgg gtcggtcgat       420
     gacaaagttg tgatccttga cgcaacggta acgccagtaa acatcaagta tcctcaagat       480
     tacgttctcc taggccaagc tcggcggaac actgaagcga tggttacgga tttggcacat       540
     aagctagaag tgcctattcc gcgaacatat cggcgtgagg cagagcgtaa ttatgtccac       600
     tttactaaac atcccaaacg aactcgtaag gcaacgcgcg ggatggtgaa gtcacagctt       660
     caatatctac gccgaaatct gcgttacatt catgaatttc aagaccaagg tggtcaactg       720
     acatctaaac aaacacagcg actggaagtt attgaaacgt tgtacgaaca acaggactac       780
     atgtaccgga acaatacgca tagtgttgaa cgccgcataa taagtttgag tcaaccattt       840
     gtgcgcccaa taaagcgagg taaggcaaaa cctaggaacg gaaccgagtt cggccccaag       900
     gttgatgtct cgattattga tggcgtggtc ggtattgaac ggttttcgtt tgataacttc       960
     aacgaaaatc aggactttga ggacgcgttg taccactacc atgatgtaca cggtgagttt      1020
     ccagacatgg cactggtgga taaactatac cgaacacgtg agaacctacg catcgccaag      1080
     aatttaggtg taaaggtgtg cggtcctaag ctcggtcgcc agcccaaata tccagatgaa      1140
     gccagtgagc gaaaggcgaa gaaagaggca cgtgaagcgg agaatgcccg tggtgagatt      1200
     gaacgcaact tcgcgctaat gaaattgaag cacgggttag gtttggtgcg cgcaaaaacc      1260
     gttgaaacca tcactacaac ggtgtttacc gcgatgatca ctgcaaatat tgacgcagta      1320
     ctccggcttt tttctttgcc gtttgtgcta tatgtgcgat atgaaggaca aatactcaag      1380
     attgagtaca acgatagtat ttag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page