(data stored in SCRATCH zone)

EMBL: CP000423.PE560

CP000423.PE560       Location/Qualifiers
FT   CDS_pept        complement(570401..570589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69426"
FT                   /db_xref="GOA:Q03BJ6"
FT                   /db_xref="InterPro:IPR025882"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BJ6"
FT                   /protein_id="ABJ69426.1"
FT                   /translation="MLKDLFTVVVGPVVVGVIIELIKRWLDLRQLLRLPLLFEDTTDCG
FT                   LHRGPSFIMPSLFAFSH"
     ttgttgaagg atctattcac agtcgttgtc ggccctgtgg tggtcggggt tatcattgag        60
     ttgatcaaac gttggctgga cttgcgacaa cttttgcgac tgccgttgct gtttgaggat       120
     actaccgatt gtgggttgca taggggacct tctttcataa tgccaagttt atttgctttt       180
     agccactag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page