(data stored in SCRATCH zone)

EMBL: CP000423.PE564

CP000423.PE564       Location/Qualifiers
FT   CDS_pept        complement(573760..576186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69430"
FT                   /db_xref="GOA:Q03BJ2"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BJ2"
FT                   /protein_id="ABJ69430.1"
FT                   /translation="MAKKKVMRKIELPLVDLLENKRKIDLLSNEKPFIIPEYIKGNLKH
FT                   QLRPYQNQALVNLDWTQRQPLADYQYNQLLFNMATGSGKTDVLAALILYLYTEFTYHNF
FT                   LFVVNTNAVVAKTYDNLLNTASPKYLFSQPLTIHGQRIELRSVTRFPSTPEDGVIYLRL
FT                   ATIQALTNELSETKENSLTYDDFKAHKLVVLADEAHHFSAGTKSKEDKKERSWEYVLDR
FT                   IRQANQHNRQFEFTATLDLQNEAIYQKYRQKIVYRYDLSRFIHQGYSKQVYRLQANNDD
FT                   ENKILNAVLLSQYRKRIANDLKIPDFKPVILFKSNKIAVSKDARTTFLSMISQLNITDL
FT                   TDFLKHQQNTSHSQALKQAYDYWLSQDLGTAIVELKRDFQAMNTINVNDSAKEGILGDL
FT                   NDLHNLNTLESSDNPFRVIFAVAKLSEGWDVLNLYDIVRIGEQSTTLNQTNSEAQLIGR
FT                   GARYNPFVYQGENSYTRRFDNQNPKYQLLESLYYHTINDPKYLDNLKKSLDKMDLPVED
FT                   DSDFDVFETNVKRAFKNSKVYQQGNLYYNEVEPVPDKEFNCLDRYGVNTTTMAEVNLVE
FT                   STWETNYNAVAIEKDPLTETRFLFKFRDAVILVKKAFSRNKFYRFNSLKQYIPTLNSLN
FT                   EFMTADNWLGNIRLYARVSNGSPALNRKQQLKAVEQYLTFVQKQIINNYQRQRGTKRFI
FT                   PVPIKSLIRDYQKKVAKHFNKSVSEMILPYSMKNKPWFVFEEAIVDKLEKSLVDLIGAF
FT                   VERLSQKYSQIYLFRNDERNTNFKLHQFKGRTTHYAGFMPDFILYLVSDELAPTI"
     atggctaaaa aaaaagttat gcgcaaaatt gaactcccac tggtcgattt attggaaaac        60
     aaacgtaaga ttgatcttct tagtaatgaa aagcccttta ttatcccaga atatattaaa       120
     ggtaatttaa agcaccaatt acgtccttac caaaatcaag ctttagttaa tctagactgg       180
     acacagcgac agccattagc tgattaccaa tataatcaat tactttttaa tatggccact       240
     ggtagtggta aaacagacgt tttagctgcc ctgatcttgt atttgtatac tgaatttact       300
     tatcataact ttctttttgt ggtaaataca aatgctgtgg tggctaagac ttatgacaat       360
     ttattaaata ctgcttcacc taaatatctt ttttcccaac ctttgactat ccatggtcaa       420
     agaatcgagc ttcgctcagt aactcggttt cctagtacac cagaagatgg tgtgatctat       480
     ttaagattag caactattca agccttgacc aatgagttaa gtgaaaccaa agaaaacagc       540
     ctcacttatg atgattttaa ggctcataaa ctagttgttt tagccgacga ggctcatcat       600
     tttagcgctg gtactaaaag taaagaggat aaaaaggaac gttcgtggga atatgtcctt       660
     gaccgcattc gtcaagctaa tcaacataat cgtcaatttg agtttactgc aactctagat       720
     ttgcaaaatg aagcgattta tcaaaaatat cgtcaaaaga ttgtttatag atacgattta       780
     agccgtttta ttcaccaagg atattctaaa caggtatatc gattacaagc aaataacgac       840
     gatgagaaca aaatactgaa tgctgttttg cttagccagt atcgtaagcg aattgccaac       900
     gacttaaaaa tacctgactt taaaccggta atcttgttta agtctaataa aattgcggtt       960
     tctaaagatg ctcgaacaac ttttttaagc atgatctcac agttgaatat aacggaccta      1020
     accgattttc ttaaacatca acaaaacact agccatagtc aagcattgaa acaagcttat      1080
     gattactggt tatcgcaaga tttgggtact gcaattgttg aattaaaacg tgactttcag      1140
     gctatgaata ctattaatgt taacgatagt gccaaagaag gaattttagg cgatttaaat      1200
     gacttgcata atctaaatac cttggaaagt tctgataatc cctttcgggt tatttttgct      1260
     gtcgctaagt taagtgaggg ctgggacgtt ttaaaccttt atgatattgt gcggattggt      1320
     gaacaatcca ctaccttgaa ccaaacaaac agtgaagctc agttgattgg tcgaggagca      1380
     cgctacaatc cttttgttta tcaaggcgaa aactcttata cacgtcgttt tgacaaccag      1440
     aatcctaaat atcagttatt agagagtctt tattaccaca ctatcaatga tcctaagtac      1500
     ctagataacc ttaagaagtc acttgataag atggacctac ctgtcgaaga tgatagtgat      1560
     tttgatgttt ttgaaactaa tgttaaacgg gcctttaaaa actctaaagt ttatcaacag      1620
     ggtaatcttt actacaacga agttgagcct gtaccagata aagaatttaa ttgccttgac      1680
     cgttatgggg ttaataccac cacaatggct gaagtcaatt tggtagagag cacttgggaa      1740
     acaaattata atgctgttgc tattgagaaa gatcctttaa cagaaactag atttttgttt      1800
     aagtttcgag atgccgtaat cttagttaaa aaagccttct cacgtaataa gttctatcgg      1860
     tttaactctc tgaagcaata tattcctact ttgaattctt taaatgaatt tatgacagct      1920
     gataattggt tgggaaatat tcgtttgtat gctcgtgtca gcaatggttc accagcctta      1980
     aatcgtaagc agcaacttaa agcagttgaa caatatttaa cttttgttca aaaacagatt      2040
     attaataact atcaaagaca acgcggtacc aagcgcttta ttccagttcc tataaaatcc      2100
     ttgattaggg actaccaaaa gaaagttgcc aaacatttta ataaatcagt cagtgaaatg      2160
     atcttaccct actcaatgaa aaataaacct tggtttgttt ttgaagaagc cattgttgat      2220
     aagctggaga agtctttagt tgacttaatc ggcgcctttg ttgagcggtt aagtcaaaaa      2280
     tatagtcaaa tttatttatt tagaaatgat gaacgcaata ctaatttcaa gctacatcaa      2340
     tttaaaggtc ggacaactca ttatgccggg ttcatgcctg attttatcct ctatttagtg      2400
     agtgatgaat tagcccctac catctag                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page