(data stored in SCRATCH zone)

EMBL: CP000423.PE580

CP000423.PE580       Location/Qualifiers
FT   CDS_pept        complement(591877..592590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0602"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69446"
FT                   /db_xref="GOA:Q03BH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BH6"
FT                   /protein_id="ABJ69446.1"
FT                   /translation="MWKIVADAVPQMAAAGIKYTIPIALVSFAIGLIIALITALTRISV
FT                   RKGFWITFAKGFASFYVWLFRSTPLLVQLFIVFFGLPSLIIPGIFPHGIKLDPVIAGII
FT                   TFSLNTGAYCAETIRAALLSIDHGQWEAAYSVGLPRRLVLREIIIPQALRTAVPPLSNS
FT                   FISLVKDTSLAASITIVEMFQVSQQIAAENYQPLLMYSLVALLYAVVCTVLTWGQRYLE
FT                   KVTSRYTSNVQTTQL"
     atgtggaaaa ttgttgccga tgccgttcca caaatggcgg ctgcgggaat caaatacacg        60
     atcccaatcg cgctagtttc attcgcgatt ggcctcatca ttgcattgat cacggcactg       120
     acgcgcatct cggtacgaaa aggcttttgg atcacctttg caaaaggctt cgcttcattt       180
     tatgtttggc ttttccgttc aaccccgttg ctggtgcagt tgttcattgt cttctttgga       240
     ctaccaagtc tgatcattcc gggcattttt cctcacggta tcaaactcga tcctgtgatc       300
     gcgggcatca tcacgttttc gttgaacacg ggggcttatt gtgctgaaac aattcgagca       360
     gcgctactgt cgattgatca cggtcaatgg gaggctgcct actcagtcgg cttgccgcgg       420
     cgcttggttc tgcgtgaaat tatcattccg caagcactac gcacggccgt cccgccacta       480
     tcaaacagtt ttatcagtct cgtcaaggac acctcactgg cggcttcgat cactatcgtc       540
     gaaatgtttc aggtgagtca gcagatcgct gctgagaact atcagccatt attgatgtat       600
     tcactggtcg ctttgcttta tgccgttgtc tgcaccgtct taacttgggg acagcgctat       660
     cttgaaaaag tcacgtcacg ctataccagc aatgtgcaga caacgcagct gtaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page