(data stored in SCRATCH zone)

EMBL: CP000423.PE590

CP000423.PE590       Location/Qualifiers
FT   CDS_pept        604568..605230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69456"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BG6"
FT                   /protein_id="ABJ69456.1"
FT                   /translation="MTLAGVMLPITSVFAADEPIKKTSVGEVRVGVDPDNPDPNNPDNP
FT                   DGSKDILSLVKVPDLKFKSVSVEQLATGQQTLPLTSNTVTDKPVKNEPAGNASDGNNQG
FT                   LLNITDYRGNGAGWKLEAQAGELKNAAGQKLAGSLLLAGVAKTDETDNNPTAISQAELV
FT                   LEGSGVQVWNAASGQGQGRNTGVFTSADTVLKLSQNTAAYGGKYQTAITWTLTNAPA"
     atgacacttg caggggttat gctgccaatc acaagtgtct ttgccgcaga cgaaccaatc        60
     aagaaaacct ctgttggtga agttcgagtt ggggttgatc cagataatcc tgatcctaac       120
     aatccggaca atcctgatgg gtctaaggat attttgtcat tggtcaaggt gccagatctg       180
     aagttcaaga gtgtcagtgt tgagcaactg gcaactgggc agcaaacatt gccgctcaca       240
     agcaatacag ttactgacaa accggttaag aacgaaccag caggaaatgc cagcgatggg       300
     aataatcaag gtttgttaaa tatcactgat tatcgcggca atggtgctgg ttggaagtta       360
     gaagctcagg cgggcgaact caagaatgcg gctggacaaa aactggctgg tagtcttttg       420
     ctggctgggg ttgcgaaaac cgacgagact gataataatc caactgctat tagtcaggct       480
     gagttggtct tggaaggcag tggggtgcag gtatggaatg ccgcaagtgg tcaaggccaa       540
     ggccgcaaca caggtgtttt cacttcggca gataccgtgt tgaagctttc ccaaaataca       600
     gcggcatacg gcggcaagta tcaaacggct atcacttgga cgctgaccaa cgcaccagct       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page