(data stored in SCRATCH zone)

EMBL: CP000423.PE591

CP000423.PE591       Location/Qualifiers
FT   CDS_pept        605385..605744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69457"
FT                   /db_xref="GOA:Q03BG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BG5"
FT                   /protein_id="ABJ69457.1"
FT                   /translation="MTRSIWRFLISLIIVFGVLGEGIMAAHQVRAATSIGEVVVIDDRP
FT                   KPDKDHNAPGTEVSKPKEEPSVPPRQQVDRLPQTSEGGQTWYPLIGFALLMMSSLRLQL
FT                   WFKRKDRGDDDENRD"
     atgacacgaa gtatatggcg ctttttgatc agtttgatca ttgtgttcgg cgtcctcggt        60
     gaagggatca tggccgctca ccaagtgcga gcggcaacct ccatcggtga agtcgtcgtg       120
     attgacgatc ggccaaaacc cgacaaggat cataatgcac caggaacaga agtatcaaaa       180
     ccaaaggaag agccttcggt accgccacgc caacaggttg atcgtttgcc acagaccagc       240
     gaaggcggac aaacctggta tccgctgatc ggttttgcac tcctgatgat gagcagtttg       300
     cgtcttcaac tgtggtttaa acgaaaagac aggggggacg atgatgaaaa tcgtgactaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page