(data stored in SCRATCH zone)

EMBL: CP000423.PE6

CP000423.PE6         Location/Qualifiers
FT   CDS_pept        6920..9541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68872"
FT                   /db_xref="GOA:Q03D50"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D50"
FT                   /protein_id="ABJ68872.1"
FT                   /translation="MDDRQESRITNVNLGETMRKSFLEYAMSVIVARALPDVRDGLKPV
FT                   QRRILYGMNELGVTPDKPYKKSARIVGDVMGKYHPHGDSSIYEGLVRMAQDFSYRYMLV
FT                   DGHGNFGSVDGDGAAAMRYTEARMSKIAVEMLRDINKDTIDFQDNYDGTEKEPVVLPAR
FT                   FPNLLVNGATGIAVGMTTNIPPHNLSETISALHVLMDNPDATTADLMQALPGPDFPTGG
FT                   VVMGKSGIRHAYETGRGTIVLRGKVDVQTEKSGRERIVITEIPYMVNKAKMVERIADLV
FT                   HEKKIDGIVTLRDESDRDGMRIVIDVRRDASASVILNNLYKLTPLQTGFSFNMVAIVNG
FT                   APKVLSLKQILQYYLDHQENVIRRRTQFDLRKANAREHILEGLRIALDHIDEIITIIRS
FT                   SETGDKAKVILMDKFKLSDKQSQAILDMRLVRLTGLEREKVESEYKDVEAAIADYTDIL
FT                   ARPERVHQIIYNELLDIQKKFGDKRRTELLVGEVLSLEDEDLIEQEDVVITLSHNGYVK
FT                   RLATSEFKAQNRGGRGIQGMNVHDDDFVERLISTSTHDVLLFFTNKGKVYRSKGYEIPE
FT                   YGRTAKGIPIINLLGVGAGEKIQTVINVHEGENDDRYLFFVTQKGVVKRTPVKEFANIR
FT                   SNGLIALNLKDEDELNNVILTSGQDNILIGTHLGYSVTFKEQDVRSMGRSATGVRGIRL
FT                   REHDYVVGSDILKPDSEVFVISEKGYGKRTAAKEYPIKGRGGKGIKTANITAKNGPLAG
FT                   VTTVDGTEDILVMTDSGVMIRFNIQSVSQTGRATLGVRLIRVDDDAKVATMAKVEPESD
FT                   DPDDGSKPDQPTSPTDGSAAPTSQQPADGSYAGDADQQVSQLLDRAEADQPEQHDTGDQ
FT                   PE"
     atggatgatc gtcaagaaag ccgaattacc aatgtgaacc tcggcgaaac aatgcgtaaa        60
     tcattccttg aatacgcgat gagtgtcatt gtggcgcggg ccttgcctga tgtgcgcgat       120
     ggcctcaagc cggttcaacg gcggattctg tacggtatga atgaactcgg cgtgacgccg       180
     gataaaccgt acaagaagag tgcgcgtatt gttggggatg tcatggggaa ataccatccg       240
     catggtgata gctcgattta tgaagggctc gtacgaatgg cacaggactt cagctatcgt       300
     tacatgctgg tcgatggcca cgggaacttt gggtctgtcg atggtgacgg tgccgctgcg       360
     atgcggtata ccgaagctcg catgagcaaa atagcagtcg agatgctgcg tgacatcaac       420
     aaagatacga ttgattttca ggataactat gatggcacgg aaaaagaacc ggttgtttta       480
     ccggcacgtt ttccaaatct gttggtcaat ggggcgactg ggattgcggt cggtatgacg       540
     accaatattc cgccgcataa tctgtcagag actatctcgg cgctgcacgt gttgatggat       600
     aatccagatg ccacgacagc tgacctaatg caggcactgc caggacctga ttttccaacc       660
     ggcggcgttg tgatgggtaa gtcaggcatt cgccatgctt atgaaactgg ccgcggcacg       720
     attgttttgc gcgggaaagt tgatgttcag acggagaagt ctggccgtga acggatcgtg       780
     attaccgaga ttccatatat ggttaacaaa gccaaaatgg ttgaacggat cgcagatttg       840
     gttcatgaaa agaaaatcga tgggatcgta accttgcggg atgaatctga ccgtgacggg       900
     atgcggatcg tcattgatgt gcgccgtgat gctagtgcat cagttatttt gaataacttg       960
     tacaagctca cgccactaca aaccggcttt tcattcaaca tggtggcaat cgttaatggt      1020
     gcgccaaaag tgttgagctt gaaacagatc ctgcaatatt atctggatca tcaagaaaac      1080
     gtcattcgtc ggcggacgca atttgacctg cgtaaggcca acgctcgtga acatatcctc      1140
     gaaggattac ggattgcgct tgatcatatt gatgaaatca tcacgattat ccgtagttct      1200
     gaaactggcg acaaggcaaa agtcatcttg atggacaagt ttaagttgtc tgacaagcag      1260
     agccaagcaa tcttggatat gcggctggtt cggttgaccg gtttggaacg cgagaaggtt      1320
     gaaagcgaat ataaggatgt tgaagcagcg attgctgatt atactgatat tcttgctaga      1380
     ccagaacgtg ttcatcagat catctacaac gaattgctgg atattcagaa gaagttcggc      1440
     gataagcgcc gtactgaatt actggtcggt gaagtgctca gtcttgaaga tgaagatctg      1500
     atcgagcaag aagacgtggt catcacgttg agtcataacg gctacgtcaa gcgattggca      1560
     accagtgaat tcaaggcaca aaatcgcggg ggtcgcggta ttcaggggat gaacgtccat      1620
     gatgacgatt tcgttgaacg cctgatttcg acttccacgc atgatgtcct gctcttcttc      1680
     accaacaaag gtaaagttta tcgcagcaag ggttacgaaa ttcctgagta cggtcgaacc      1740
     gcaaaaggga ttccaattat caacttgctt ggtgtcggtg ccggtgaaaa gattcaaacg      1800
     gttatcaacg tgcatgaagg cgaaaatgat gatcgttatc tcttcttcgt cacgcaaaaa      1860
     ggcgttgtta agcgcacacc ggtgaaggaa ttcgccaata ttcgcagcaa cggactgatt      1920
     gcgttgaatc tcaaggatga agacgaactg aataatgtca tcctaacgtc cggacaagac      1980
     aatatcctga tcgggacgca tctgggttac agtgtgacct tcaaggaaca agacgttcgc      2040
     tcaatgggac gttcagcgac tggggttcga ggtattcgtt tacgtgaaca cgattacgta      2100
     gtgggttccg acattctcaa acccgattcc gaagtctttg tcatttcaga aaaaggttac      2160
     ggtaaacgga cggcagcgaa ggaatatccg attaaaggtc gtggcggtaa agggatcaag      2220
     acagccaaca tcaccgccaa gaatggtccg ttggcagggg tcaccaccgt tgatggtacc      2280
     gaagatattc ttgttatgac tgattctggt gtcatgattc gcttcaatat tcaaagtgtt      2340
     tcgcaaactg gccgagcaac gttaggggtt cgtttaattc gagttgacga cgatgccaag      2400
     gttgcaacga tggccaaggt tgaaccggaa agcgacgatc cagacgatgg cagcaagcca      2460
     gatcagccaa ctagcccgac agacggttct gctgcaccaa cctcgcagca gccagctgat      2520
     ggttcgtatg ctggcgatgc cgatcagcaa gtgagccaat tgcttgatcg cgctgaagct      2580
     gatcaaccag agcaacatga tactggcgac cagcctgaat aa                         2622
//

If you have problems or comments...

PBIL Back to PBIL home page