(data stored in SCRATCH zone)

EMBL: CP000423.PE651

CP000423.PE651       Location/Qualifiers
FT   CDS_pept        complement(679150..680088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0677"
FT                   /product="tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69517"
FT                   /db_xref="GOA:Q03BA5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005926"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BA5"
FT                   /protein_id="ABJ69517.1"
FT                   /translation="MILTVTLNPSIDVSYPLEHLKIDTVNRVKTVRKTAGGKGLNVSRV
FT                   IHMLNHEITATGFIGGYFGKWLENQLDRDGIDHDFFPIDAETRSSIAMLHDGGEQTEIL
FT                   EAGPTIAAEDAEKFLSHFDSLLDKSDLITISGSMPQGLPADYYTQMIAHAGQKNVKVLL
FT                   DTSGATLKSALEAPVKPLLIKPNEEELGGLLNRDVDKTDYTALKHDLMDPIFDGVDWIV
FT                   VSLGAAGAFVKHLDKFYHAAIPKIKVINPVGSGDSTLAGLAMGIHDGKSDEDIMKTAMT
FT                   TGMLNTMEAETGFVNPAKFDEYFAKVTIESY"
     atgattttaa cagtgacttt aaacccatcc attgacgtct cctacccgct cgaacatctc        60
     aaaatcgaca ccgtcaatcg ggtgaaaacg gtacggaaaa ctgctggcgg taagggatta       120
     aatgtatctc gcgtcattca tatgttaaat cacgagatca cagcaactgg ctttattggc       180
     ggctattttg gcaagtggtt ggaaaatcag cttgatcgtg acggtattga ccatgacttc       240
     ttcccgattg atgccgaaac ccgcagttcg attgctatgt tacatgatgg cggcgaacag       300
     actgaaattc tggaagccgg accaacaatt gctgccgaag atgccgagaa atttctcagc       360
     cattttgaca gcctgttaga caaaagtgat ttgatcacca tctccggttc catgccgcaa       420
     ggattaccgg ctgattatta cacccagatg attgcccatg caggtcaaaa aaacgtcaaa       480
     gtgcttctgg atacatcagg tgccacttta aaatccgctt tagaagcgcc tgtgaaaccg       540
     ttgctgatta agccaaacga agaagaactt ggcggcctgc tcaaccgtga tgttgacaaa       600
     accgactaca cggccttgaa acacgatctg atggacccga tttttgatgg tgtcgattgg       660
     atagtcgtgt ccctaggtgc ggctggtgcc ttcgtaaaac atttggataa gttctatcac       720
     gctgccattc caaagattaa ggtcattaat cctgtgggct ccggcgactc aacattggct       780
     ggcttagcca tgggcattca tgatggcaaa tcggatgaag acatcatgaa aacggcgatg       840
     acaaccggga tgttgaacac catggaagca gaaaccggct tcgtcaatcc agctaagttt       900
     gatgaatatt ttgccaaagt caccatcgaa tcctattaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page