(data stored in SCRATCH zone)

EMBL: CP000423.PE659

CP000423.PE659       Location/Qualifiers
FT   CDS_pept        688493..688636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69525"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B97"
FT                   /protein_id="ABJ69525.1"
FT                   /translation="MASLSKEQKKALIAKVEKERQDHPEKKSKKSGFETIDEEAERLES
FT                   EN"
     atggcatcat tgagcaaaga acagaaaaaa gctttgatcg ctaaagttga aaaggagcgc        60
     caagaccatc ccgaaaagaa gtcaaagaag tctggcttcg aaacgattga cgaagaagca       120
     gaacgccttg aaagcgaaaa ttaa                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page