(data stored in SCRATCH zone)

EMBL: CP000423.PE686

CP000423.PE686       Location/Qualifiers
FT   CDS_pept        715079..716374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0712"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69552"
FT                   /db_xref="GOA:Q03B70"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B70"
FT                   /protein_id="ABJ69552.1"
FT                   /translation="MNAEKGIKHQQRRLFIGQLLSFAGLFVVLGIIVFFLYERSIYQDI
FT                   DHTLEQQQAMILNPNEETTKLGPQQPGTRVTHPAPFRTNMVVFNQKGRIINQAMLGERF
FT                   YAYFKNLKLDRSAQNKLQTLTTSTGTFRTLLIKAPKYSADPQYAGHYVLILQNTDAQEA
FT                   AIRSFRQVLIVTIILFWALALGLSYWLSTRAMRPIVRSWQRQQDFVADAAHELRAPLAV
FT                   IQSKQEALLTKPQATIIDESEAIATSLGETKRLRQLTDDLLTIAKADSNTIEIELVDQP
FT                   FEKAFEPQLSSYQDIAVSQQKSFTTTLPKAGHALFDTARMKQLLVILLDNAFKYTQAGD
FT                   SIWVEVTQTPRDWQLQVGNSGPSIADADKARVFERFYREDASRSRQTGGSGLGLAIARW
FT                   IVTMHHGHIEVKDVHPHGALFIATFPNKPRMR"
     atgaacgcag aaaaaggtat taaacatcag caacgtcgct tattcatcgg gcaactgttg        60
     agctttgcgg gcttgtttgt ggtattaggt atcattgttt ttttcttata tgagcgctca       120
     atttatcaag acattgatca caccttagag cagcaacaag caatgattct taatccaaac       180
     gaagaaacga caaagcttgg tccgcagcaa cccggtacga gagtcactca cccagcacct       240
     ttccggacca acatggtggt ctttaaccaa aaaggccgca tcattaatca agccatgctt       300
     ggtgagcggt tttatgctta ctttaaaaat ttaaaactgg atcgatcagc gcaaaacaag       360
     ttacagacat tgaccacatc aactggaaca ttccggacgc tattaatcaa agcacctaaa       420
     tacagcgcag atcctcagta tgccggtcac tatgtgttaa ttttgcaaaa taccgatgca       480
     caggaagcag cgattcgatc atttcggcag gttctgattg tcaccattat tcttttttgg       540
     gcattggcac tcggcttgtc atactggttg tccacacgtg ctatgcggcc aattgtccgg       600
     tcatggcagc ggcaacagga cttcgttgcc gacgcagcac acgagttgcg ggcgccactt       660
     gccgtgattc aaagcaagca ggaagccctg ctgacgaaac cacaagcgac catcattgac       720
     gaaagtgagg caattgcgac ttcgttgggt gagacgaaac gcttgcgtca gctgaccgat       780
     gatctgctaa caattgccaa agccgatagc aacaccatcg aaattgaatt ggttgatcaa       840
     ccttttgaaa aggcctttga accacagctg tcttcttatc aagatattgc tgtcagtcag       900
     cagaagtcct tcacaacaac gctacccaag gccggtcatg cactgtttga cacggcgagg       960
     atgaaacaac tgttagtgat tttactggac aatgccttta aatatacaca ggcgggtgat      1020
     tctatctggg ttgaagtgac acagacacca cgtgattggc agttgcaggt tggcaattct      1080
     gggccgagta ttgcggatgc tgataaagct cgcgtttttg aacgttttta tcgagaagat      1140
     gcctcgcgta gtcgccaaac aggtggtagt ggacttggtt tagcaattgc tcggtggatt      1200
     gtgaccatgc atcacgggca tattgaagtc aaggatgtcc atcctcatgg cgcacttttc      1260
     atcgcgacct tcccaaataa gccgcgtatg cgttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page