(data stored in SCRATCH zone)

EMBL: CP000423.PE695

CP000423.PE695       Location/Qualifiers
FT   CDS_pept        725049..725348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69561"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B61"
FT                   /protein_id="ABJ69561.1"
FT                   /translation="MAEQSENTVTRTQKQEGADAIMDKGYVTERDIPEMMSKTWSEQLL
FT                   DAVNDELRLRTVTNRTVLQQFHYYMGNGTIIYDPGQLNSEGAKIALQHALGFRK"
     atggcagaac aatcggagaa caccgtgacg cgaacacaaa agcaagaagg tgcggatgcg        60
     attatggata agggttacgt cactgagcgg gatattccgg aaatgatgag caaaacatgg       120
     agcgaacaac ttcttgatgc tgttaatgat gagttgcgct tgcgcacggt gaccaatcgc       180
     accgtgttac agcaatttca ctattacatg ggcaacggca cgatcattta tgatccgggt       240
     cagctgaact ctgaaggggc caagatcgcc ttacagcacg ccttaggttt ccgcaaataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page