(data stored in SCRATCH zone)

EMBL: CP000423.PE700

CP000423.PE700       Location/Qualifiers
FT   CDS_pept        729327..729521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69566"
FT                   /db_xref="GOA:Q03B56"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B56"
FT                   /protein_id="ABJ69566.1"
FT                   /translation="MTILRGAKWTLITLTLVATLLLFSNFATAGILLIALDIFLSFFYA
FT                   VIKSRCDRRQMHKMPLLHN"
     atgacaatcc tacggggcgc aaaatggaca ttaattactc tgaccctcgt ggcaaccttg        60
     ctgttattca gcaactttgc gacagccggc attttgttaa tcgcgcttga tattttcttg       120
     agtttcttct acgcggtcat caaaagcaga tgtgatcggc gtcagatgca taagatgcca       180
     ttattgcata attaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page