(data stored in SCRATCH zone)

EMBL: CP000423.PE77

CP000423.PE77        Location/Qualifiers
FT   CDS_pept        75083..76222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68943"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CX9"
FT                   /protein_id="ABJ68943.1"
FT                   /translation="MMNKKLSVAVLVLGCLSLLAACQPSNVVSKVKQHTVTVLNQKDQV
FT                   WRETEAVSATVTSQGSLKNEQVKPDNKLSPAITNAGKFYSVATFKQSDYATIKKAIQKN
FT                   EAQPKTLRFVTVKQVNATLKAMGATKQIKALTDLVYTQQADGHTFPSNDGYLIEGDHLY
FT                   EVIMAYTTGGNASTVNRGNVYSRKIKYGTTKQLTFNEVAGTWQSTAGDQATVRDDQLVT
FT                   IQNKSYVRGKVENLSHLQGEKLYRNTAYSLRQTQLVKQNAKLTQESLVAGDLYDNMYLF
FT                   LSKTKMARVNTSGVTIFTKKADQSQIPAQVFEVFRLLDQRHTDEVAAYLLPHGTDTYSV
FT                   ALTRSINYATVNYEGGATGAESVSIQDGKISVGPDLNHN"
     atgatgaaca aaaagttgag cgtggcagtg ttggtgctcg gatgtttgag cttactggct        60
     gcttgtcaac cgagtaacgt tgtgagcaag gttaagcagc atacagtgac cgttttaaac       120
     caaaaggatc aagtgtggcg cgaaactgag gcggtttctg ccacggtaac gagtcagggg       180
     agtttgaaaa acgagcaagt aaaaccggac aacaagttgt cacctgctat cacgaatgcc       240
     ggtaaatttt acagtgtcgc tactttcaaa cagagcgatt atgccacgat caaaaaggct       300
     attcagaaaa atgaagcaca gcctaagaca ctccgcttcg tcacagtgaa gcaagtgaat       360
     gcgacgctta aagcgatggg ggcaaccaaa cagattaaag cattaacgga tttggtctat       420
     acacaacaag cggatggtca cacttttcct agtaatgatg gctatctcat tgaaggcgat       480
     catttgtatg aagtgatcat ggcttacacg acagggggta atgctagtac cgtcaatcgc       540
     ggcaatgttt actcgcggaa aatcaagtac gggacaacta agcaactgac tttcaatgaa       600
     gtggccggca cttggcaaag tactgcaggc gatcaagcta ccgtgcgaga tgatcaattg       660
     gtgaccattc agaacaagtc gtatgttcgc ggcaaagttg aaaatctaag tcacttgcaa       720
     ggagaaaagt tatatcgaaa cacggcgtac tccctgcgac agactcaact ggtcaagcaa       780
     aatgctaagt tgacccagga atcattggtg gcgggcgact tgtatgacaa tatgtatcta       840
     ttcctatcaa agacaaagat ggcacgtgtg aatactagcg gcgtgaccat ttttacgaaa       900
     aaggcagatc aaagccagat tcctgctcaa gtctttgagg tttttcggtt attagaccag       960
     cgccatacag acgaagtcgc agcttattta ttaccgcacg ggactgacac ttattctgtg      1020
     gcactaactc gtagcatcaa ctatgcaacg gtaaattatg aaggcggcgc aacgggagca      1080
     gaatcagtgt cgattcagga tggcaaaatt agtgttggac cagacttaaa tcacaattga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page