(data stored in SCRATCH zone)

EMBL: CP000423.PE88

CP000423.PE88        Location/Qualifiers
FT   CDS_pept        84297..84833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68954"
FT                   /db_xref="GOA:Q03CW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CW8"
FT                   /protein_id="ABJ68954.1"
FT                   /translation="MIQFERKILYSYLKVLSITLICFALLVINGLFSEAEMRGTNQAVF
FT                   HNSVSLWNIFMHNSLLFILSLVISPLTKGFGGAFIIFLSLMGLFFKLNAITVFAAHLYL
FT                   TTVVITIPHSFFELAVMVIPISFAKAVRDNSVTSQIKWMKVFLIVLIFGELILLVAAFV
FT                   ETKIALPEMMRVFNE"
     atgattcaat ttgaaagaaa gatactatat tcatacctaa aagtgctgag cattacactg        60
     atttgtttcg cgttgcttgt gattaacggc ttattttctg aggctgagat gagagggaca       120
     aatcaggctg tttttcataa ctcagttagc ttgtggaaca tctttatgca taatagtttg       180
     ttgtttatac tttcgttggt gatcagtcca ttaacgaagg gctttggagg agcttttata       240
     attttcttgt ctttaatggg tttatttttt aaattaaatg cgattaccgt ttttgcggct       300
     catttatatt tgacaaccgt agtaataacg ataccgcaca gcttttttga gttggcagtt       360
     atggtgattc cgatttcatt tgctaaagcg gtcagagaca actcagtaac atcacagata       420
     aaatggatga aagtattcct gattgtcctt atttttggtg agttaatact gcttgttgcc       480
     gcgtttgtgg aaacaaaaat tgcattgccg gaaatgatga gggtatttaa tgaatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page