(data stored in SCRATCH zone)

EMBL: CP000423.PE9

CP000423.PE9         Location/Qualifiers
FT   CDS_pept        11092..11388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0009"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68875"
FT                   /db_xref="GOA:Q03D47"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03D47"
FT                   /protein_id="ABJ68875.1"
FT                   /translation="MAETKYEVTYIIRPDLDDAAKTELVERFDNILKENGANIIDSKDW
FT                   QKRKLAYEINKYNEGLYHIVNLSAEDDKAINEFDRLGKINNDILRHMIVKRED"
     atggctgaaa ccaaatatga agtcacttat atcatccgtc cagatttgga cgatgctgca        60
     aagactgaat tggttgaacg ttttgacaat attttgaagg aaaatggtgc caacatcatt       120
     gattccaagg attggcaaaa gcgtaagctc gcatatgaga tcaacaagta caacgaaggt       180
     ctctatcata tcgtgaactt gtccgcagaa gatgacaaag cgatcaatga atttgatcgt       240
     cttggcaaga tcaacaacga tattctgcgt cacatgatcg tgaagcgaga agactaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page