(data stored in ACNUC7421 zone)

EMBL: CP000431.CHAA

CP000431.CHAA        Location/Qualifiers
FT   CDS_pept        337391..338350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="RHA1_ro00263"
FT                   /product="sodium calcium/ proton antiporter, CacA family
FT                   protein"
FT                   /note="bifunctional; tc: 2.A.19.1.1; GO_component:
FT                   GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92099"
FT                   /db_xref="GOA:Q0SK37"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK37"
FT                   /protein_id="ABG92099.1"
FT                   /translation="MLAAVHHAEVVAHKVGEPFGSLILAVAVTVIEVGLIVTLMISGGP
FT                   ATASLARDTVFAAVMLTVNGIMGLSLFVGARRYGVALFNAEGTGAALATVASLATLSLV
FT                   LPTFTTSRPGPEFSSAQLIFAAVASLVLYGMFVLTQTGPHRHFFLPVIPDEPVAVEDRN
FT                   AAPPSGRVAGMSLALLVLALCAVVGLAKVESPTIEDAVEDAGLPQSIVGVVIALLVLLP
FT                   ETLAAVRAAQRNRIQISLNLALGSAMASIGLTIPAIAVASIWLDGPLLLGLGPTQVVLL
FT                   AITVVVGMLTVVPGRATRLQGGVHLVLLAAYVFLSVNP"
     gtgcttgccg ctgttcatca cgccgaggtg gttgcacaca aggtcggtga gccgttcgga        60
     tcgctgattc tcgctgtcgc cgtcaccgtc atcgaggtcg gattgatcgt gacgctgatg       120
     atctcgggtg gcccggcgac ggcctcgttg gcccgcgaca cggtattcgc ggctgtgatg       180
     ctcaccgtca acggaatcat ggggttgtcg ctgttcgtag gcgcacgaag atacggggtt       240
     gcgctgttca atgcggaagg tacgggcgcg gcactggcga ccgtagcgtc gctggctacc       300
     ctgagcctgg tgctgccgac cttcacgaca agccggccgg gccccgaatt ctcctcggct       360
     cagttgatat tcgcggcagt ggcctcgctg gttctgtacg ggatgttcgt cctcacccaa       420
     accggaccgc atcgacactt cttcctgccc gtcatccccg acgaacctgt ggccgtcgag       480
     gaccggaacg cggcaccccc gtcgggcagg gtggcgggca tgagcctcgc gctgttggtg       540
     ctggcgctgt gcgcagtcgt gggattggcg aaggtcgagt cccccacgat cgaggacgca       600
     gtcgaggatg ccggattgcc acaatccatc gtcggtgtgg tcatcgcgct gctcgtgctt       660
     ctgccggaaa ccctcgccgc ggtccgggcg gcgcagagaa accggatcca gatcagcttg       720
     aatctggccc tgggatcggc gatggccagc atcgggttga ccattccggc cattgcggtt       780
     gcctcgatct ggctggacgg accacttctg ctcggcctcg gtcccaccca ggtggtgctg       840
     ctcgccatca ccgtggtggt gggcatgctg acggtggtcc cgggccgtgc cacccgcctc       900
     caaggtggcg tccacctggt gctgctggct gcctatgtgt tcctctccgt caacccctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page