(data stored in ACNUC7421 zone)

EMBL: CP000431.DPS

CP000431.DPS         Location/Qualifiers
FT   CDS_pept        105754..106293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="RHA1_ro00101"
FT                   /product="DNA protection during starvation protein"
FT                   /note="GO_component: GO:0009289 - fimbrium; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0008199 - ferric
FT                   iron binding; GO_process: GO:0006879 - iron ion
FT                   homeostasis; GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91937"
FT                   /db_xref="GOA:Q0SKJ9"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ9"
FT                   /protein_id="ABG91937.1"
FT                   /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVGP
FT                   NFIGVHEMIDPQVELVRGYADAVAERIAALGNSPDGTPAAIARDRTWDDYSVKRDTAQA
FT                   HLGALDLVYSGVVGDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSGGSL
FT                   SNNGAHSEKQAAAQAR"
     atgtcgaagt tcaccgtgcc aggtctttcc gacgatcagg gcgcgcgagt cgccgacata        60
     cttcagaagc ggctcagcgc atacaacgat ctgcatctga cgctcaagca cattcactgg       120
     aatgtggtgg gtccgaattt catcggcgtg cacgagatga tcgacccgca ggtcgagttg       180
     gtgcggggct acgcggacgc cgtcgccgaa cgcatcgccg cgctggggaa ttcgcccgac       240
     ggcaccccgg ccgcgatcgc ccgcgaccgc acctgggacg actactcggt gaagcgggac       300
     acggcgcagg cgcatctcgg tgccctcgac ctcgtctaca gcggcgtcgt cggagacaac       360
     cgcaaggcga tcgctgagac gggcgacctc gacccgatca ccgaggacct tctcatcggg       420
     caaaccggcg aactcgagaa gttccagtgg ttcgtccgcg cccatctcga gaactccggc       480
     ggcagcctct cgaacaacgg cgcgcactcc gagaagcagg cagccgcgca agcgcggtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page