(data stored in ACNUC7421 zone)

EMBL: CP000431.PE1

CP000431.PE1         Location/Qualifiers
FT   CDS_pept        complement(1391..2581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00001"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000074 - regulation of progression through cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91837"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU9"
FT                   /protein_id="ABG91837.1"
FT                   /translation="MIWPEHRIETRPWNPRHRQGSRADRTLETVDVMIPPMIGALDCDL
FT                   VGVVARAHEEAVIAVARLEAGFGEHLAPLSDFLLRSESVASSKIEHIDAGWRAFGKALA
FT                   GGKSSAEAKSQLAAVKALIAMVDAAGDGPITGDTLLGAHRLLMAPDYYTARDSGRFRDV
FT                   QNWIGGSDYTPIDALFVPPPPELVDELLADLLEFANRTDLPILAQAAIAHAQLESIHPF
FT                   TDGNGRIGRALISAILRRRRLTHRVTVPLASVMLADTRRYFDHLTRYRAGDADGFVEYV
FT                   ARAAIVSSEAAQDSARALAELPSYWRDIARPRSNSADEKIIDALLGTPIFGADTAQQIT
FT                   GTTDASAYRALGRLTAAGVLEVLSESKRNQIWAATGVLAELDALSTTIGRRTTEHL"
     gtgatctggc cggagcatcg tatcgagact cggccctgga acccgcgtca tcggcagggt        60
     tcgcgcgcgg accgcaccct ggagaccgtc gacgtgatga tcccgccgat gatcggcgcc       120
     ctcgactgcg atctggtcgg tgttgttgcc cgcgcgcacg aggaggcggt catcgcggtg       180
     gcccgcctcg aagcagggtt cggcgagcac ctggcgccgc tgtcggactt cctgctgcgc       240
     agcgagtcgg tggcgtcgtc gaagatcgag cacatcgacg cgggctggcg cgcgttcggc       300
     aaggcgctgg ccggtggcaa gtccagcgcg gaggccaagt cccagctcgc cgcggtcaag       360
     gccctgatcg cgatggtcga cgcggccggg gacggcccga tcaccggtga caccctgctc       420
     ggtgcgcacc ggttgctgat ggcaccggac tactacaccg cccgcgactc cggccgattc       480
     cgcgacgtgc agaactggat cggcggcagc gactacaccc cgatcgacgc gctgttcgtg       540
     cccccgccac cggaactggt cgacgagctg ctggcggacc tgctggagtt cgcgaaccgc       600
     accgacctgc cgatcctcgc gcaggccgcg atcgcacacg cccagctcga gtccatccac       660
     ccgttcaccg acggcaacgg acgcatcggc cgcgccctga tcagcgcgat cctgcgccgc       720
     cgccgcctga cccaccgggt caccgtcccg ttggcgtcgg tgatgctcgc cgacacccgc       780
     cgctacttcg accacctgac ccgctaccgg gcgggtgatg ccgacgggtt cgtcgagtac       840
     gtcgcccgcg cggcgatcgt ctccagcgag gccgcgcagg actctgcccg cgccctggcc       900
     gaactcccca gctattggcg cgatatcgcg cggccgcgca gcaactccgc cgacgagaag       960
     atcatcgacg ccctcctcgg cacgccgatc ttcggcgccg acaccgccca gcagatcacc      1020
     ggcaccaccg acgccagcgc gtaccgcgcg ctgggccggc tcaccgcggc cggggtgctc      1080
     gaggtgctct ccgagagcaa gcgcaaccag atctgggccg ccaccggtgt gctcgccgaa      1140
     ctcgacgccc tgagcaccac catcggcagg cgcaccaccg agcacctgta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page