(data stored in ACNUC7421 zone)

EMBL: CP000431.PE10

CP000431.PE10        Location/Qualifiers
FT   CDS_pept        15608..16624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00010"
FT                   /product="probable transposase, mutator family protein"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91846"
FT                   /db_xref="GOA:Q0SKU0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU0"
FT                   /protein_id="ABG91846.1"
FT                   /translation="MLTEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAK
FT                   GLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLDPVYPVLFIDAIHVKI
FT                   RDGQVANRPVYVAIGVTTAGEREILGLWAGDGGEGAKFWLAVLTEIRNRGVADVCIAVC
FT                   DGLKGLPDAITTVWPLTVVQTCLIHLLRNTFRYASRQYWDEMSRDLRPIYTAVNEAAAK
FT                   EQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAV
FT                   RARGHFPSEQAALKCLYLATRSLDPSGKGRARWVTRWKPALNAFAITFEGRITPTVI"
     gtgctcaccg aaatcggacc ggtacagatc caggtgccac gagacaccga tgcctcgttc        60
     gatccgcaga tcgtcaagaa acggcagcga cgcctgaccg gggtcgacga aatcattttg       120
     tccctctcgg cgaaaggcct gaccacaggc gaaatcgcgg cacacttcga cgacgtctac       180
     ggcgcatcgg tctcgaagga gaccatcagc aagatcaccg acaaggtcct cacggagatg       240
     gccgaatggt ccgtccgtcc cctcgacccg gtgtatccgg tgctgttcat cgatgccatc       300
     cacgtcaaga tccgcgacgg tcaggtcgcc aaccggcccg tctacgtcgc catcggcgtc       360
     accaccgccg gggaacgcga gatcctcggg ctgtgggcag gtgacggcgg ggagggggcc       420
     aagttctggc tcgccgtcct gacggaaatc cgcaaccgcg gggtcgcaga cgtgtgcatc       480
     gccgtctgcg acggactcaa gggactgccc gacgcgatca ctaccgtgtg gccactcacg       540
     gtggtgcaga cctgcctgat tcacctcttg cgtaacacct ttcgttacgc atcgcgtcag       600
     tactgggacg agatgtcacg ggacctgcgg ccgatataca ccgctgtcaa cgaggccgcg       660
     gccaaggagc agttcaccga gttcgccgac aaatgggggc cgaggtatcc ggcgatcgtc       720
     cggctgtggg aaagcgcctg gagcgagttc gtgcccttcc tcgactacga ccccgagatc       780
     cgccgggtca tttgctcgac gaacgcgatc gagtccctca acgcgcgcta ccggcgggcg       840
     gtgcgggcga ggggccactt ccccagcgag caggccgcgc tcaagtgcct ctacctcgcc       900
     acccggtcgc tggacccgtc cggtaaggga agagcacgat gggtgacgag gtggaagccg       960
     gccctcaacg cgtttgctat cacattcgaa ggccgaatca ccccaaccgt gatctag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page