(data stored in ACNUC7421 zone)

EMBL: CP000431.PE100

CP000431.PE100       Location/Qualifiers
FT   CDS_pept        complement(105031..105390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00100"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91936"
FT                   /db_xref="GOA:Q0SKK0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91936.1"
FT                   /translation="MRTPRRSNAQRGSACGSARCESGGRRCAPRPGRSKGGTMSAGHTL
FT                   PARQSTALRTGTVRWFNAEQGFGFLAPADGSDDIFVHVSEIAGDGHRILEEGQRVSFAV
FT                   CRTETGDQARDVRIA"
     gtgcgcacgc cgaggaggag caatgctcaa cgtggctctg cttgtggttc tgctcgttgc        60
     gagtctgggg ggcggcgctg cgctccacgg cctggccgat cgaagggcgg cacgatgagc       120
     gccgggcaca cgctgccggc ccggcagtcg acggcactgc gcacgggcac ggtgcgatgg       180
     ttcaacgccg aacagggttt cggtttcctc gccccggccg acggatccga cgacatcttc       240
     gtgcacgtct ccgaaatcgc cggcgacggt caccgcattc tcgaggaagg gcagcgcgtc       300
     agcttcgccg tctgccgcac cgagaccggc gaccaggcac gcgacgtccg gatcgcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page