(data stored in ACNUC7421 zone)

EMBL: CP000431.PE103

CP000431.PE103       Location/Qualifiers
FT   CDS_pept        106670..106948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00103"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91939"
FT                   /db_xref="GOA:Q0SKJ7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ7"
FT                   /protein_id="ABG91939.1"
FT                   /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIILNIVVGIVGGLL
FT                   GGFILRLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRSTAGRR"
     gtgctaggac tgggaattct gggctggatc atcatcggcg gcctcgccgg gtggatcggc        60
     agcaagatca tgaagaccga cgcccagatg ggcatcatcc tcaacatcgt cgtcggaatc       120
     gtcggcggtc tcctcggcgg cttcatcctc cgcctcttcg gcaccgacgt cgagggcggc       180
     ggtctctggt tcagcttctt cacctgcctc ctcggtgcgg tgatactcct gttcctggtc       240
     aagctcgtga ccgggcgaag cacggccggg cgacgctag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page