(data stored in ACNUC7421 zone)

EMBL: CP000431.PE104

CP000431.PE104       Location/Qualifiers
FT   CDS_pept        107026..107589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91940"
FT                   /db_xref="GOA:Q0SKJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ6"
FT                   /protein_id="ABG91940.1"
FT                   /translation="MASTPAVGYSWGMDSRGPARDDANWNFRARHETETQRLDRNWSGL
FT                   LQELRVVQTGVQLLTGFLLTLPFQQRFEDLSDSEVAIYLATVALSVTSTMLLVAPAGLH
FT                   RMLFRRHALPDLVSASHRLAICGIATLALALIGVVALIFSFVISPIAGVVAAAVALAMF
FT                   CGLWVFAAILRSRHRSTDGDSADR"
     gtggcctcga cgccggcggt ggggtactcg tgggggatgg acagtcgagg accggctcgg        60
     gacgatgcga actggaactt ccgcgcccgg cacgagaccg agactcaacg actcgaccgg       120
     aactggagcg gccttctcca ggaactgcgc gtcgtgcaga ccggggtgca actactcacc       180
     ggcttcctgt tgacgttgcc gttccagcaa cggttcgagg acctctcgga cagtgaggtt       240
     gccatctatc tggcgaccgt cgcactgtcg gtgacgtcga ccatgctcct ggtggccccg       300
     gccggcctgc accgcatgct cttccgtcgg cacgcgctcc cggatctcgt gtccgcatcg       360
     catcgcctcg cgatctgtgg catcgccacc ctcgcgctgg cgctgatcgg tgtggtggcg       420
     ttgatcttca gcttcgtgat ctcacccatc gccggagttg tcgccgccgc ggtggccctc       480
     gcgatgtttt gcggactctg ggtcttcgcc gcgatcctgc ggtcgcggca tcgctcgacc       540
     gacggcgatt ccgccgatcg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page