(data stored in ACNUC7421 zone)

EMBL: CP000431.PE105

CP000431.PE105       Location/Qualifiers
FT   CDS_pept        107669..108112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91941"
FT                   /db_xref="GOA:Q0SKJ5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91941.1"
FT                   /translation="MTDIHRGDTPRVQPPGAAHDLDDLSTVQLVERLTDQVTGLVRTEM
FT                   THALTEVKDKGTRFGIGAGVSGAGVLLLLSGFGALVATAILGLATALDPWLAALIVAAV
FT                   LIVVGSVVAAVGARRAKNALPPVPARTANSVRADVDTVKEGLR"
     atgaccgata tccatcgcgg cgataccccg cgggtccagc cgcccggcgc tgcacacgat        60
     ctcgacgatc tgtcgacggt ccaactcgtc gaacgactca ccgatcaggt gacgggactc       120
     gtacggaccg agatgaccca tgccctcacc gaagtgaaag acaagggaac gcgcttcggg       180
     atcggagcgg gtgtctccgg agcgggcgtg ctgctcctgc tgtccggatt cggggccctc       240
     gtcgccaccg caattctggg attggcgacg gcactcgatc cgtggctggc cgcgttgatc       300
     gtggccgccg tactgatcgt ggtgggcagc gtcgtggcgg cggtcggagc ccgccgcgcc       360
     aagaacgcgc tgccgcctgt acccgcgcgg acggcgaaca gcgtgcgcgc cgacgtcgac       420
     accgtcaagg aaggccttcg atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page