(data stored in ACNUC7421 zone)

EMBL: CP000431.PE106

CP000431.PE106       Location/Qualifiers
FT   CDS_pept        108548..108871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91942"
FT                   /db_xref="GOA:Q0SKJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ4"
FT                   /protein_id="ABG91942.1"
FT                   /translation="MTYQPDNGPSRELNSEHHPQDDAHTMRNHAGEAITDSRNWPGYIL
FT                   IAAGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVVGTGLVLLERRRVKALEGRELTDQ
FT                   EGH"
     gtgacgtatc agccggacaa cggacccagc cgcgaattga actccgagca tcacccccag        60
     gacgatgcgc acaccatgcg caatcacgcc ggtgaggcga tcaccgacag ccggaactgg       120
     ccgggataca tcctgatcgc cgccggaatc gccgtgctcg gtctgacact ggtcgcggcc       180
     ggctacggat tcgagggctg ggcactgatc ggtggcatcg cctgcgtcct gtgcctcgtc       240
     gtcggcacgg gtctcgttct cctcgaacgg cggcgcgtca aggccctcga aggcagggaa       300
     ctgaccgatc aggaagggca ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page