(data stored in ACNUC7421 zone)

EMBL: CP000431.PE107

CP000431.PE107       Location/Qualifiers
FT   CDS_pept        108868..109449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91943"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91943.1"
FT                   /translation="MTDPKVDLHQYLQAARDALLWKLDGLSEYDIRRPMTPTGTNLLGL
FT                   VKHLTGVEIGYFGETFGRSVEYPPWVTGAAEDNVDMWATPGESREYIVGQYRTAWAHAD
FT                   HTIRALPLDAPGRVPHWPGDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTVGMRA
FT                   DNTNVPAEDRMWWETYRTRLERAAREAGQG"
     ttgacagatc cgaaggtgga ccttcaccag tacctccaag ccgcccgcga cgctctgctg        60
     tggaagcttg acgggctgtc cgaatacgac atccgtcggc cgatgacccc gaccggcacg       120
     aacctgctgg ggttggtcaa acacctgacg ggcgtcgaga tcggctactt cggcgagacc       180
     ttcggccgat ccgtcgaata cccaccgtgg gtgaccggcg ccgccgaaga caacgtggac       240
     atgtgggcga cccccggcga gtcacgcgag tacatcgtcg ggcagtaccg gacagcgtgg       300
     gcgcacgccg accacaccat ccgggctcta cccctcgacg cgcccggccg ggtaccgcac       360
     tggccgggcg accgccgcga cgtcaccctg caccggattc tcgtgcacgt gatcgccgaa       420
     acccaccggc acgcagggca cgccgacatc gtccgcgaac tcgtcgacgg cacggtcggc       480
     atgcgcgcgg acaacaccaa cgtgcccgca gaagaccgga tgtggtggga gacctaccgg       540
     acccgtctcg aacgtgccgc acgcgaagcc ggccagggct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page