(data stored in ACNUC7421 zone)

EMBL: CP000431.PE108

CP000431.PE108       Location/Qualifiers
FT   CDS_pept        complement(109457..111190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00108"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91944"
FT                   /db_xref="GOA:Q0SKJ2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91944.1"
FT                   /translation="MERRVSARKVAHRRRIAGSLIAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDTPRDGTRMLVAPDGTRLPASYSSDYSSPWIDEVV
FT                   NAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGYS
FT                   EGADVARRVAMEVGNQDGRDGSYDILDPAAVVGVVILADAGRNLGGGPFPGSENEFRNP
FT                   DGFDLAYQSGQKGTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAIN
FT                   VGRQLNVDSLQKDGLTPATGQDLAVVLGQIALAAFADIQSQGDWMQSDETFLDVLIKVS
FT                   DPAYKPDSGAAQSDTSTGPISSNQAVDLVYLPAKVRNEIIGFIADNQNTIQVAMSDPYQ
FT                   QTLGEGTGHHFDYWRDANAGSGKPLTSAQYAAAWLTHLAQEAEKGESRAAAAEASTAKL
FT                   ASASTKETETEAARVAPTTTDSAKKAQLAGNPVSATTTTSSSPTPTTTVATTTSPEPTT
FT                   AVEVAAETTTSVSAPQAVAGTPDTSVVTTTAAEPTTTTESESPTTTTPVVTTTTLQPAA
FT                   G"
     atggaacgtc gcgtttcggc acgcaaggtc gcgcatcgac gaaggatcgc aggcagtctg        60
     atcgcgcccg gcgcgttggg gctggcggcg ctgctcgcga ctccgtggtc gaatccgggt       120
     tcaccggcca cgacggcgac tgccttgacg gcggcggcct cggacgcgtg ctacgacatg       180
     gtcagcatcg ccgtcgccgg ccgcggtgac accccgcgcg acgggacccg aatgctcgtg       240
     gcacccgatg gcacacggct tcccgcgtcg tactccagcg actacagcag tccatggatc       300
     gacgaggtgg tgaatgcgcc gcagcaatcc gtcggtggtg ggtcctatgc cgcggtctac       360
     atcgagtatc cggccaacat gaactcgtac gaggacgccg tgaacgccgg cgtcgacaac       420
     accgagaccg tgatgcggtc gattcacgcg tcgtgcccgg acacgaagtt ctcgatcgtc       480
     ggctacagcg agggcgccga tgtggcacgg cgggttgcga tggaggtcgg caaccaggac       540
     ggccgggacg gctcgtacga catcctcgat ccggcggccg tggtcggtgt ggtcatcctg       600
     gcggatgccg gccgcaacct cgggggaggg ccatttcccg gttcggagaa cgaattccgc       660
     aatcccgacg gcttcgacct tgcctaccag tcggggcaga agggcacgtc cgggcgggga       720
     gcgttgcccg gcacgtcggg cagcttcggt gccctggacg ggaaggtggc atcgttctgc       780
     tcggaaggcg acctgacctg ctccgcaccc gagaacattg cgctactgca gctcgcgatc       840
     aacgtgggac ggcaactgaa cgtcgactcg ctgcagaagg atgggctgac ccctgcgacg       900
     ggacaggatc tcgcggtggt gctcgggcag atcgccctcg ccgcgttcgc ggacatccag       960
     tcgcaaggcg attggatgca gtccgacgag acgttcctcg acgttctgat caaggtgtcg      1020
     gatccggcgt acaagcccga tagcggtgcg gcgcaatcgg acacgtcaac tggtccgatc      1080
     tcgtcgaatc aggcggtcga cctggtctac ctgcctgcga aggtgcggaa cgagatcatc      1140
     gggttcatcg cggacaatca gaacacgatc caggtggcga tgagcgaccc gtatcagcag      1200
     acgctggggg aggggaccgg ccatcacttc gactactggc gtgatgcgaa tgccggcagc      1260
     gggaaaccgc tgacttctgc ccagtacgcc gcagcgtggt tgacccacct ggcgcaggag      1320
     gcggagaagg gcgagtcgcg cgcggccgcg gcggaagcgt cgaccgcgaa acttgcctct      1380
     gcctccacga aggaaacgga aacggaagcg gctcgggtcg cacccaccac cacggacagc      1440
     gcgaaaaagg ctcagttggc gggcaacccg gtcagcgcga ccaccacgac cagcagttcg      1500
     ccgaccccca cgacgacggt cgcgacgacg acgtcaccgg aacccacgac ggctgtggaa      1560
     gtggccgcag aaaccacgac ctcggtgtcg gcgcctcagg ccgtcgccgg aacaccggac      1620
     acatccgtgg tgactaccac cgcggcggaa cccaccacga ccactgaatc ggagtcaccg      1680
     acgaccacca cgccggtcgt caccacgacg acgcttcaac cggcggccgg gtga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page