(data stored in ACNUC7421 zone)

EMBL: CP000431.PE109

CP000431.PE109       Location/Qualifiers
FT   CDS_pept        complement(111306..111737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ1"
FT                   /protein_id="ABG91945.1"
FT                   /translation="MHQRGVNRRRKTRDVRSILPERQRPLERRGVEVGRVRGAGGDHRR
FT                   RRHPYSRGAKGCGVYRRWSGTGVSRRRFAQALVREMPHTLALLQTGRLNEWRATLLVRE
FT                   TACLSAADRAIVDRRLCSDPAAARDSAVETLLITHLRAS"
     gtgcaccaac gcggcgtgaa ccgacgtcgc aagactcgcg acgtccgatc aattctgcca        60
     gaacggcaac gaccacttga gcgcagaggg gttgaagtcg gtcgggtacg cggcgcaggc       120
     ggtgatcacc gacgacgtcg ccacccgtac tcgcgcggag caaaaggctg cggggtttac       180
     cgcaggtgga gcgggaccgg ggtatcgcgt cgcagattcg cgcaggcgct ggtgcgcgag       240
     atgccgcaca ccctggctct gctgcaaacc ggtcggctga acgaatggcg agccaccttg       300
     ctggtgcggg agacagcgtg tctgtcggcc gcggatcggg cgatcgtcga ccgccggttg       360
     tgctcggacc cggccgcggc ccgagattcg gcggtcgaga cccttctgat cacacacctc       420
     cgcgcctcgt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page