(data stored in ACNUC7421 zone)

EMBL: CP000431.PE110

CP000431.PE110       Location/Qualifiers
FT   CDS_pept        111753..112478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0007600 -
FT                   sensory perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91946"
FT                   /db_xref="GOA:Q0SKJ0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ0"
FT                   /protein_id="ABG91946.1"
FT                   /translation="MPNGPSEMTHTGGDAPSAVFARLAEMVYDGDDFTQVYQAICDAAA
FT                   TLVPGCAHASLMLKENDRHVTVAASDDIAAQVDALERAEQEGPCLDAIENDAPQVESEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLMIRGRKVGALNLFSDNAGEFTDKSIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLREGLASNREIGKAIGLLMAFHDISEGRAFDLLRKTSQDMN
FT                   IKLTGVAREVIAHHNSKFD"
     atgccgaatg gtccttcgga gatgacgcat accggaggcg acgcgcccag tgccgtcttc        60
     gcgaggctgg ccgagatggt ctacgacggc gacgacttca ctcaggtcta ccaggccatc       120
     tgcgatgccg ctgccacttt ggttcccggg tgtgcccacg ccagcctcat gctgaaggag       180
     aacgatcgcc acgtcaccgt ggccgcgagc gatgacatcg cagcccaggt cgacgcgctc       240
     gagcgagccg agcaggaagg gccctgcctc gatgcgatcg agaacgacgc accgcaggtc       300
     gagagcgagc tcgcccgttc gacgcagtgg ccgcgccttg cccgtcgggc cattgccgaa       360
     accccggtcc ggggcgctgc cggtttccgg ctcatgatcc gtggacgcaa ggtcggcgcc       420
     ctcaatctgt tctcggacaa cgccggagaa ttcaccgaca aatcgatcga tcaggcgatt       480
     ctgatcacgg ccttcgcggc ggtgacgctg acagcgctcc acgaacatca ggaagcacag       540
     accttgcgtg agggcctggc cagcaaccgc gagatcggaa aagcgatcgg actgttgatg       600
     gccttccacg acatctccga aggaagagca ttcgacttgc tgcgcaagac gtcgcaggac       660
     atgaacatca agctcacggg tgtcgcacgg gaagtcatcg cgcatcacaa ttcgaagttc       720
     gactga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page