(data stored in ACNUC7421 zone)

EMBL: CP000431.PE112

CP000431.PE112       Location/Qualifiers
FT   CDS_pept        113149..113472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00112"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004518 - nuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI8"
FT                   /protein_id="ABG91948.1"
FT                   /translation="MSGRQPPRGHPTASVAETVRVLLDTAGPTYVSESHVTLKDTPTFL
FT                   FQLLSPAHRRTSISALGRAGYVRYDGSTATRLHAAAVRVDDEYGGDLRRPARACDQETS
FT                   ATS"
     atgtccggga ggcagcctcc tcgtgggcat ccgacggcaa gcgtcgcgga gaccgtgcgt        60
     gtgcttctcg acacggccgg tccgacgtac gtgtccgagt cgcacgtgac cttgaaggac       120
     accccgacgt ttctttttca actgctgtcg ccggcacacc gtcgcacgag catctccgca       180
     ctcggcagag caggttacgt gcgctatgac gggagcacgg ctacccggct gcacgccgcc       240
     gcggttcgag tcgacgacga gtacggcggt gacctgcgcc ggccggcccg cgcctgtgat       300
     caggagacct ccgccacttc gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page