(data stored in ACNUC7421 zone)

EMBL: CP000431.PE114

CP000431.PE114       Location/Qualifiers
FT   CDS_pept        114072..114644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91950"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI6"
FT                   /protein_id="ABG91950.1"
FT                   /translation="MCRPKGSSSNGGAVDRPSRKATIEKIRAGMSRSRARLRPRSEHGQ
FT                   NGPYRTKESTMAKYLLLGHYRGAPASVNDVAMDQWTPEEISAYVQYMNDFAARLESTGE
FT                   FVDSQALSPEGTFVRYDGEGRPPITDGPFAETKDLIAGWMVIDVETHERALELAGELSA
FT                   APGADGKPIHEWLGVRPFLAVSPTATE"
     atgtgcaggc cgaagggatc atcgtcgaac ggtggagcag ttgaccgtcc gtcacggaaa        60
     gcgacgatcg agaaaatccg tgcagggatg tcgagaagcc gcgcgcggct tcgtccccgg       120
     agtgaacacg gccagaatgg gccgtaccgc accaaggaga gcacgatggc caagtacctg       180
     ctgctcgggc actaccgggg cgcgcccgca tcggtcaacg acgtggccat ggaccagtgg       240
     acgccggagg agatctccgc ctacgtgcag tacatgaacg acttcgccgc tcggctcgaa       300
     agcaccggcg agttcgtcga cagtcaggca ctctccccgg agggcacgtt cgtccgctac       360
     gacggcgagg gacgaccgcc gatcaccgac ggcccgttcg cggagaccaa ggacctgatc       420
     gccggctgga tggtgatcga cgtcgagacc cacgagcggg cactcgagct ggccggcgag       480
     ctgtccgcgg ccccgggtgc ggatggtaaa ccgatccacg aatggctcgg ggtgcgccca       540
     ttcctggccg tctctcccac cgctacggag tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page