(data stored in ACNUC7421 zone)

EMBL: CP000431.PE117

CP000431.PE117       Location/Qualifiers
FT   CDS_pept        complement(117414..117848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91953"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI3"
FT                   /protein_id="ABG91953.1"
FT                   /translation="MNITTLVLEKSRVVVQWREDGMSYVAREEDLPRLEARPDTIGSIW
FT                   HPPFTERQVVGFEEAPPGDLDRPSWWAMYGYADPEVQVTVTVDDQPDPIVHRIGLVWAC
FT                   EWISYPTRAHVHRSDWDTPDLIRFIRPEFLPPAPYPEHVR"
     atgaatatca cgactctcgt ccttgagaag tcacgcgtag tggttcagtg gcgtgaagac        60
     gggatgagtt acgtagcgcg ggaggaagac ctgccgcggc tagaagcccg gccggacact       120
     attggctcga tctggcaccc accgttcacc gaacgacagg tggtcggatt cgaggaggca       180
     cctcctggag atctagaccg gccatcgtgg tgggctatgt acggctacgc cgacccagaa       240
     gtgcaggtca cggtcacagt cgacgatcaa ccggacccga tagtccaccg catcggcctt       300
     gtctgggcat gtgaatggat cagctacccc acacgcgcgc acgtacacag gtccgactgg       360
     gacacacctg acctgatcag gttcattcgc ccagaatttt tgccaccagc cccttaccca       420
     gaacacgtca ggtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page