(data stored in ACNUC7421 zone)

EMBL: CP000431.PE118

CP000431.PE118       Location/Qualifiers
FT   CDS_pept        complement(117896..119854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00118"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91954"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI2"
FT                   /protein_id="ABG91954.1"
FT                   /translation="MARVTKYLNLPRPKRASPAKTLILASLASVLFATGGGIAAAQPTT
FT                   TPTPTPSTTTTTPTSPTPTETTAERVTPSSTVPSSPPASPSGTVPAVESTPEASAAPDV
FT                   TTPAPSGSAQTDSSAPTTTPSESTTPSSAPANGKKIPYTGLPTENPNATIVPGKMRSDR
FT                   EELPEGFTKEDADKAEMKEAELQKQASGLRAAVAPGCQVYWPSDFQVCGAIRDKYNSLG
FT                   AQFSFLGFPTTNELTNPDGFGRRSVFVNGPIYWSAASGAHPVVNHFFAAWQRNNWETGP
FT                   LGYPTTDEIVNPDGLGRRQEFQNTAAIYWKLNEAWAIRGAIRDKWNTVNAERPGSLLGY
FT                   PLSDEIVLPDGQGRMNRFERGVLYWHPSHGAHPVVSGILDQWTASGYETGAYGYPTADE
FT                   VTLQDIARQQQFQNGILYSPKRVAADAAYKDYMQAPAAAQCAAPLGSRVGAWTCTKAGG
FT                   AAAALPAPPQFNGPGEYCDVNFGGCWNVYDDFRADYQGDVVFGAGPQIIGNGSVVVEWK
FT                   LAGPYTQITRATVSSNDAVMGRVVFAGALQNGAVGVANGGSLIHSTQPQFAPGPHMTGR
FT                   AVGLPNPSGMELEDRRMRDHNYVVQISVEFSEWPGYWYFYVRSPVAHYDDDDPNDIYRF
FT                   MGADQLPGNPVGGDWKW"
     atggccagag tgacgaagta cctgaatttg ccgcgcccga agcgggcttc accagcaaaa        60
     acgttgatcc tcgcatcgtt agcgtcggta ttgttcgcga ccggcggagg gatcgccgca       120
     gcgcaaccca ccaccacacc gacacccaca ccgagcacga ccaccaccac accgacatcg       180
     ccgacgccca cggagaccac tgcggagcgt gtaaccccga gcagcactgt tccttcgtcg       240
     ccgccggcat ccccgtcggg aacggtaccc gccgtcgagt cgacgccaga ggcctctgcc       300
     gcacccgacg taacaacgcc ggcgccatcg gggagcgccc aaaccgacag tagtgcgccg       360
     acaacgacac cgagcgaatc caccaccccc agctcagccc ctgcaaatgg gaagaagatc       420
     ccttacacag ggttaccgac cgagaacccc aacgcgacca ttgtcccggg caagatgcgt       480
     tcggatcgag aagagctgcc cgaagggttc acaaaggaag acgccgacaa ggccgagatg       540
     aaggaagcgg agctacagaa acaagctagc ggcctccggg ccgcggtggc ccccggctgc       600
     caggtgtact ggccgtcgga cttccaggtc tgcggtgcca tccgcgacaa atacaactca       660
     ctcggcgcac agttcagctt cctgggcttt cccaccacca acgaactcac gaaccccgac       720
     ggatttggac gcagatccgt attcgtcaac ggaccgatct actggtccgc cgccagtggc       780
     gcccacccgg tggtgaacca cttcttcgcg gcctggcaac ggaacaactg ggaaactggg       840
     cccctcgggt atccgacgac cgacgagatc gtcaacccag acggtctggg ccgccgccaa       900
     gagttccaga acaccgccgc catctattgg aaactcaacg aggcatgggc catccgtggc       960
     gcgatccgcg acaaatggaa caccgtcaat gccgaacggc caggcagcct cctcgggtac      1020
     ccactctctg atgagatcgt cctacccgac gggcagggcc ggatgaaccg cttcgaacgc      1080
     ggcgtcctct actggcaccc ctcccatgga gcccacccag tagtgagcgg aatcctcgat      1140
     caatggaccg cttcaggtta cgaaactgga gcgtacggct accccactgc cgacgaagta      1200
     acactgcaag atattgcgcg acaacaacaa ttccagaatg gcatcctgta ctcaccgaag      1260
     cgggttgcag cagatgccgc atataaggac tacatgcagg cacccgcggc cgcccaatgt      1320
     gccgcaccgc tggggtctcg cgtcggtgcg tggacatgca caaaagcagg tggtgcagct      1380
     gcggctcttc cggcacctcc ccagttcaac ggtccgggtg aatattgcga cgtcaacttc      1440
     ggcggttgct ggaatgtcta tgacgacttc cgcgctgact atcaaggcga cgttgtgttc      1500
     ggcgcgggtc cgcagatcat aggcaacggc tccgtagtcg tggaatggaa gctagccggt      1560
     ccctacactc agatcacacg ggcaaccgtc agctcgaacg atgccgttat gggacgcgtc      1620
     gtatttgctg gtgcgcttca gaatggtgcc gtcggagttg cgaatggtgg atccctcatt      1680
     cattccaccc agccgcagtt cgcgccggga ccgcacatga cgggacgcgc cgtcggcttg      1740
     ccgaatccct caggtatgga actcgaagac cgacggatgc gtgaccataa ctacgtcgta      1800
     cagatatcgg tagaattcag cgaatggcca ggctactggt acttttacgt acgcagcccc      1860
     gttgcgcact acgacgacga cgacccgaac gacatttaca gattcatggg agccgatcag      1920
     ctaccaggta accccgtggg gggagactgg aaatggtga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page