(data stored in ACNUC7421 zone)

EMBL: CP000431.PE119

CP000431.PE119       Location/Qualifiers
FT   CDS_pept        120244..120813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91955"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI1"
FT                   /protein_id="ABG91955.1"
FT                   /translation="MELVPQPPPDDDEFVYELTERQRRAIMATAAVLAATAYGDTEALG
FT                   DQVIESEDHGSLLAALPPCTWGQDASWRRQMARAFDDLAGDITAGTDPEPTCTGEEMAL
FT                   HIILTRASSDHLAGHLDQMLAKAPAHDNDTDWAAPTSFLFQDHDVLTLYDEDGVPVRDG
FT                   VNLEPEDWFLPFGDAVARDPGRGFRF"
     atggaactgg tcccgcaacc accacctgat gacgatgagt tcgtgtacga gctgaccgag        60
     cggcagcgtc gcgcgatcat ggccactgcc gccgtcttgg cggccacggc gtacggcgac       120
     accgaggccc tgggcgatca ggtgatcgag tccgaggacc acggatcact actcgctgcg       180
     ctgccgccct gcacctgggg acaggacgca tcgtggaggc ggcagatggc gcgggcgttc       240
     gacgacctcg ccggcgatat caccgccggg acggacccag agccgacctg caccggggag       300
     gaaatggcgt tgcacatcat tttgacccgc gcgagcagcg atcacctcgc cggtcacctc       360
     gaccagatgc tggccaaggc gccggcacac gacaatgaca ccgactgggc ggcgcccacc       420
     agtttcttat tccaggacca tgatgtgctg actctgtacg acgaggacgg cgtcccggtc       480
     cgcgatgggg tgaacctcga acccgaggac tggtttctgc ccttcggcga tgccgtcgcc       540
     cgggacccgg gccgcggttt ccggttctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page